Lus10001127 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042633 138 / 5e-44 AT5G67265 45 / 2e-07 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G122800 70 / 3e-17 AT5G67265 / unknown protein
Potri.007G048400 40 / 1e-05 AT5G67265 56 / 7e-12 unknown protein
PFAM info
Representative CDS sequence
>Lus10001127 pacid=23170020 polypeptide=Lus10001127 locus=Lus10001127.g ID=Lus10001127.BGIv1.0 annot-version=v1.0
ATGAACACAAAAGGGGTAGAGAGGTTGAATGAGGAAGGTGCAATAGAGACCAAAGTGGAGACTGTAGATCGCCGGTCATCGGTAGGGGAAGGAGAAGCCG
GGAGAGAAAAGGTTGGAGTTGTTCATCTGCGGCGGAATAATAATGATGATAAGGACTCCTCCAGTACTGCCGGAGGTGTTCTAGCGGGTGCAGCTGCTGC
CGTTTCCAACACTTTGAAGTCTGCTAAGGAAGCCATCATGGGTAAAGCCAACAACGGCAACAAGCAGACTGGTGGCACAGATAATCCACAGTGA
AA sequence
>Lus10001127 pacid=23170020 polypeptide=Lus10001127 locus=Lus10001127.g ID=Lus10001127.BGIv1.0 annot-version=v1.0
MNTKGVERLNEEGAIETKVETVDRRSSVGEGEAGREKVGVVHLRRNNNDDKDSSSTAGGVLAGAAAAVSNTLKSAKEAIMGKANNGNKQTGGTDNPQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001127 0 1
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10024009 6.5 0.8130
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Lus10001776 78.8 0.6907
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Lus10027062 91.2 0.6929
AT1G49475 B3 AP2/B3-like transcriptional fa... Lus10007192 143.5 0.6587

Lus10001127 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.