Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67070 76 / 2e-18 RALFL34 ralf-like 34 (.1) AT2G33775 41 / 2e-05 RALFL19 ralf-like 19 (.1) AT4G15800 40 / 3e-05 RALFL33 ralf-like 33 (.1) AT3G05490 39 / 9e-05 RALFL22 ralf-like 22 (.1) AT3G16570 39 / 0.0002 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT1G35467 38 / 0.0002 RALFL5 RALF-like 5 (.1) AT1G28270 37 / 0.0007 RALFL4 ralf-like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003931 [exp] 69 / 7e-16 AT5G67070 112 / 6e-33 ralf-like 34 (.1) Lus10037460 [exp] 50 / 5e-08 AT1G53800 387 / 3e-126 unknown protein Lus10020647 [exp] 42 / 2e-05 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10029893 [exp] 41 / 2e-05 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10015172 [exp] 41 / 2e-05 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10000502 [exp] 38 / 0.0003 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10037512 [exp] 37 / 0.0005 AT4G15800 131 / 9e-41 ralf-like 33 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G026900 [exp] 74 / 3e-18 AT5G67070 94 / 6e-26 ralf-like 34 (.1) Potri.005G139100 [exp] 72 / 5e-17 AT5G67070 118 / 4e-35 ralf-like 34 (.1) Potri.007G044700 [exp] 71 / 8e-17 AT5G67070 119 / 1e-35 ralf-like 34 (.1) Potri.004G044900 [exp] 44 / 1e-06 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 44 / 1e-06 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.013G017400 [exp] 38 / 0.0004 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.005G025800 [exp] 37 / 0.0008 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.008G208200 [exp] 37 / 0.001 AT4G15800 132 / 2e-41 ralf-like 33 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10001132 pacid=23170021 polypeptide=Lus10001132 locus=Lus10001132.g ID=Lus10001132.BGIv1.0 annot-version=v1.0 ATGGCTCCTTCGTTAGTTGATTTTCTTCTGCTAGTCACTCTGTTTCTGTCCATGTCACTTGACAATGCCAACCAAGTAATAGCGATGGACGGTTTGCAAT GGCAATCCTATGCATCAACATCAAAAGTCTCCTTCTACGAGGAGGACGAAGAAGGTGAAGCCTACAATGGTGAAGGGAGATCTCTATACTGGAGATCCCG CAGGAGGCGGAACTACATATCATACGGAGCATTATCGGCAAACAAAGTACTCTGTCCACCTCGATCGGGAAGGTCATACTATACCCACAACTGCTACGGT GCTAACCAGCCTGCTAATCCTTACCAACGCGGCTGCTCTTGCATCTCTCATTGTAGGAGATGA
AA sequence Show only first row Show all	>Lus10001132 pacid=23170021 polypeptide=Lus10001132 locus=Lus10001132.g ID=Lus10001132.BGIv1.0 annot-version=v1.0 MAPSLVDFLLLVTLFLSMSLDNANQVIAMDGLQWQSYASTSKVSFYEEDEEGEAYNGEGRSLYWRSRRRRNYISYGALSANKVLCPPRSGRSYYTHNCYG ANQPANPYQRGCSCISHCRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G67070		RALFL34	ralf-like 34 (.1)		Lus10001132 [exp]	0	1
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10002894 [exp]	3.5	0.9183
AT1G01470		LSR3, LEA14	LIGHT STRESS-REGULATED 3, LATE...		Lus10010139 [exp]	3.7	0.9201
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10032282 [exp]	4.8	0.9276
AT2G17080			Arabidopsis protein of unknown...		Lus10014447 [exp]	6.7	0.9122
AT4G35200			Arabidopsis protein of unknown...		Lus10023953 [exp]	9.5	0.9006
AT2G17080			Arabidopsis protein of unknown...		Lus10025120 [exp]	10.2	0.9165
AT3G46170			NAD(P)-binding Rossmann-fold s...		Lus10006696 [exp]	11.0	0.8753
AT2G17080			Arabidopsis protein of unknown...		Lus10025119 [exp]	12.5	0.9112
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10014332 [exp]	14.9	0.8882
AT5G46230			Protein of unknown function, D...		Lus10001891 [exp]	16.4	0.8622

Compare expression of checked genes

Lus10001132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.