Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G43720 97 / 6e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G27130 88 / 9e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 80 / 3e-19 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22600 69 / 8e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 67 / 7e-14 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48130 66 / 3e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 65 / 3e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 61 / 6e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G08670 60 / 6e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 56 / 4e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026769 [exp] 121 / 2e-34 AT3G43720 93 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10008401 [exp] 120 / 3e-34 AT3G43720 91 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026768 [exp] 108 / 5e-30 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10008400 [exp] 102 / 1e-27 AT3G43720 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10039348 [exp] 83 / 5e-20 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 83 / 6e-20 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 76 / 2e-17 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 76 / 3e-17 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 75 / 1e-16 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G158100 [exp] 104 / 6e-28 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.004G196000 [exp] 101 / 1e-26 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 80 / 8e-19 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 76 / 4e-17 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 66 / 1e-13 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 62 / 7e-12 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085300 [exp] 59 / 6e-11 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 58 / 1e-10 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050400 [exp] 58 / 2e-10 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G169000 [exp] 55 / 3e-09 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10001153 pacid=23155730 polypeptide=Lus10001153 locus=Lus10001153.g ID=Lus10001153.BGIv1.0 annot-version=v1.0 ATGGTGACCATGATCGCCATTGCAATGATTTCGATGGGCGGCTCTGCCCAAATGATGTCCCCGGGCGCGGCTCCCTACTATAATCCAGAGGCGCCCGAAT CATCGACTGCACCGGCACCAGGAGGAGTTGACTGCTTTACGCAGCTGCTGAACTTGTCGGACTGCTTGACTTATGTGGAAAGTGGAAGCAAGCTGAGCAA ACCGGAAAAGCCATGCTGCCCAGAGCTGGCCGGGTTGGTAGAGAGTAACCCGATCTGCCTATGCCAGCTTCTGACAGTGAACGCTTCCTCATACGGCTTC GACATCGACAAAAACAGAGCATTTCGACTCCCTTCCGTTTGCTCCGTCGCAACTCCTCCTGTTAGCTTGTGCTCAGTGATTAACGGAAGCCCGGTGGGAG CTCCATCGGCCAGCCAAGGAGGAGAAGGCATGAGTACTAGTGCGGCAGGTCCCGGTGGAGCAATGTCACCGTCACCGGGGAGCGGTGGGGGATCAAGCAG CCGACCGTCAAGCCATAGCTCAGCTAATTATCCCATTCAACTTTCAACCCAAATGATTTTGACCACTACCATTTCCTTCCTGCTACTACGCTCCAGTAGT TCCACACTCTAA
AA sequence Show only first row Show all	>Lus10001153 pacid=23155730 polypeptide=Lus10001153 locus=Lus10001153.g ID=Lus10001153.BGIv1.0 annot-version=v1.0 MVTMIAIAMISMGGSAQMMSPGAAPYYNPEAPESSTAPAPGGVDCFTQLLNLSDCLTYVESGSKLSKPEKPCCPELAGLVESNPICLCQLLTVNASSYGF DIDKNRAFRLPSVCSVATPPVSLCSVINGSPVGAPSASQGGEGMSTSAAGPGGAMSPSPGSGGGSSSRPSSHSSANYPIQLSTQMILTTTISFLLLRSSS STL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G43720			Bifunctional inhibitor/lipid-t...		Lus10001153 [exp]	0	1
AT4G00730	HD	AHDP, ANL2	ANTHOCYANINLESS 2, ARABIDOPSIS...		Lus10036567 [exp]	1.4	0.9098
AT4G31690	B3	REM9	Transcriptional factor B3 fami...		Lus10042406 [exp]	3.0	0.8966
AT2G26730			Leucine-rich repeat protein ki...		Lus10001900 [exp]	3.5	0.8942
AT4G30400			RING/U-box superfamily protein...		Lus10008899 [exp]	5.5	0.8926
AT1G01630			Sec14p-like phosphatidylinosit...		Lus10004684 [exp]	5.7	0.9005
AT1G74160			unknown protein		Lus10021148 [exp]	7.0	0.8886
AT1G12330			unknown protein		Lus10024559 [exp]	8.1	0.8635
AT5G06270			unknown protein		Lus10004209 [exp]	9.4	0.8881
AT1G17200			Uncharacterised protein family...		Lus10026196 [exp]	9.5	0.8931
AT3G20395			RING/U-box superfamily protein...		Lus10021524 [exp]	9.5	0.8809

Compare expression of checked genes

Lus10001153 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.