Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35740 149 / 7e-48 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G04910 127 / 2e-39 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT4G29360 101 / 4e-26 O-Glycosyl hydrolases family 17 protein (.1.2) AT5G56590 96 / 6e-24 O-Glycosyl hydrolases family 17 protein (.1) AT1G79480 95 / 6e-24 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT3G13560 94 / 2e-23 O-Glycosyl hydrolases family 17 protein (.1.2.3) AT1G11820 90 / 6e-22 O-Glycosyl hydrolases family 17 protein (.1.2) AT5G63240 84 / 6e-22 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G05430 84 / 1e-21 Carbohydrate-binding X8 domain superfamily protein (.1) AT5G63250 82 / 3e-21 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012324 [exp] 169 / 2e-55 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10001740 [exp] 159 / 7e-52 AT5G35740 111 / 2e-33 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10039059 [exp] 137 / 1e-42 AT5G35740 157 / 3e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10038801 [exp] 129 / 1e-39 AT5G35740 146 / 1e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10031456 [exp] 97 / 3e-24 AT1G11820 796 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10034607 [exp] 92 / 9e-23 AT2G01630 691 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10015151 [exp] 91 / 2e-22 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10023276 [exp] 86 / 7e-22 AT4G05430 146 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10004546 [exp] 88 / 1e-21 AT1G29380 175 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G164600 [exp] 173 / 3e-57 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.006G016800 [exp] 157 / 8e-51 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.019G007800 [exp] 90 / 8e-24 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.019G012000 [exp] 90 / 1e-23 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.007G111000 [exp] 89 / 4e-23 AT4G05430 148 / 5e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.001G006500 [exp] 92 / 9e-23 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.008G133200 [exp] 90 / 4e-22 AT2G01630 721 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.018G068600 [exp] 90 / 4e-22 AT5G56590 685 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.003G218500 [exp] 90 / 5e-22 AT3G13560 594 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.010G108500 [exp] 89 / 1e-21 AT2G01630 708 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [flax] [poplar] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Lus10001167 pacid=23155043 polypeptide=Lus10001167 locus=Lus10001167.g ID=Lus10001167.BGIv1.0 annot-version=v1.0 ATGTCATCTTTCAACCAGAGGCTACTGCTAGTGTTCGCTGCTGCCCTCCTCCTTGTTATTTCATTATCCACTCAACAATCAGATGGGGAGATGGAGCAAT GGTGCATAGCAGACGAACAAACACCCGATGACGAGCTGCAGTCTGCCATCACTTGGGCTTGCGAGAAGGGAAGGGCAGATTGCAGTAAAGTTCAGGTGAA CCAGCCTTGTTTCTGGCCTAACACCACGATAGACCACGCGTCGTACGTCTTCAATAACTACTTCCAGCAGTTCAAGCACACTGGCGGGTCTTGTTACTTC AATGGAGCCGGCATTGTTACAGACCTTGATCCTAGCCATGGCTCTTGTCAGTTCGAGTTCATTGCCTAA
AA sequence Show only first row Show all	>Lus10001167 pacid=23155043 polypeptide=Lus10001167 locus=Lus10001167.g ID=Lus10001167.BGIv1.0 annot-version=v1.0 MSSFNQRLLLVFAAALLLVISLSTQQSDGEMEQWCIADEQTPDDELQSAITWACEKGRADCSKVQVNQPCFWPNTTIDHASYVFNNYFQQFKHTGGSCYF NGAGIVTDLDPSHGSCQFEFIA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35740			Carbohydrate-binding X8 domain...		Lus10001167 [exp]	0	1
AT5G62530		ATP5CDH, ALDH12...	ARABIDOPSIS THALIANA DELTA1-PY...		Lus10004264 [exp]	7.0	0.8984
AT4G35780		STY17	serine/threonine/tyrosine kina...		Lus10041845 [exp]	18.7	0.8926
AT5G27950			P-loop containing nucleoside t...		Lus10018999 [exp]	26.5	0.8353
AT4G37180	GARP		Homeodomain-like superfamily p...		Lus10009334 [exp]	35.7	0.8846
AT2G43370			RNA-binding (RRM/RBD/RNP motif...		Lus10025557 [exp]	37.4	0.8772
AT5G57330			Galactose mutarotase-like supe...		Lus10026106 [exp]	38.8	0.8804
AT3G53210			nodulin MtN21 /EamA-like trans...		Lus10028351 [exp]	42.7	0.8721
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10036550 [exp]	49.4	0.8620
AT4G25315			Expressed protein (.1.2)		Lus10019851 [exp]	51.6	0.8237
AT3G57040		ATRR4, ARR9	RESPONSE REGULATOR 4, response...		Lus10016334 [exp]	75.5	0.8603

Compare expression of checked genes

Lus10001167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.