Lus10001175 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G05310 115 / 1e-34 unknown protein
AT4G13500 113 / 7e-34 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G167300 119 / 3e-36 AT2G05310 148 / 2e-47 unknown protein
PFAM info
Representative CDS sequence
>Lus10001175 pacid=23155052 polypeptide=Lus10001175 locus=Lus10001175.g ID=Lus10001175.BGIv1.0 annot-version=v1.0
ATGGGCAGCTCACCAGTTCAGAGTCCATGCCACCTCAGGTGCCCCCCTTTCACTAGTACAGGAGGAGGAGATGGAGAGCTGAAGCCAAAAGATAAGAAGA
AGTTCATAACCAAAGACCAGGAGCCAGAACAGTACTGGCAAACAGCAGGAGAAAGGGAAGGAGAGAACCCAATGATGACACCTCTTCCTTACATAATCAT
ATTTGGAATGTCCACTCCTTTTGTCATCCTTGCCATTGGTTTTGCTAATGGCTGGATTAAGGTACCTATCAGATGA
AA sequence
>Lus10001175 pacid=23155052 polypeptide=Lus10001175 locus=Lus10001175.g ID=Lus10001175.BGIv1.0 annot-version=v1.0
MGSSPVQSPCHLRCPPFTSTGGGDGELKPKDKKKFITKDQEPEQYWQTAGEREGENPMMTPLPYIIIFGMSTPFVILAIGFANGWIKVPIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G05310 unknown protein Lus10001175 0 1
AT4G12830 alpha/beta-Hydrolases superfam... Lus10002142 2.8 0.9492
AT5G27290 unknown protein Lus10018966 2.8 0.9479
AT4G15510 Photosystem II reaction center... Lus10000352 3.5 0.9331
AT1G64150 Uncharacterized protein family... Lus10032330 4.2 0.9247
AT5G27290 unknown protein Lus10033822 4.6 0.9469
AT4G14605 Mitochondrial transcription te... Lus10032061 5.5 0.9305
AT3G10540 3-phosphoinositide-dependent p... Lus10037921 6.2 0.9149
AT4G37925 NdhM, NDH-M NADH dehydrogenase-like comple... Lus10042758 9.5 0.9158
AT1G74710 ATICS1, SID2, E... SALICYLIC ACID INDUCTION DEFIC... Lus10023622 9.6 0.8966
AT1G08980 ATTOC64-I, ATAM... ARABIDOPSIS THALIANA TRANSLOCO... Lus10029941 10.0 0.9231

Lus10001175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.