Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35870 53 / 2e-09 unknown protein AT2G04480 52 / 1e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001750 [exp] 207 / 8e-71 AT2G04480 54 / 2e-09 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G167700 [exp] 66 / 4e-14 AT5G55650 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001176 pacid=23155041 polypeptide=Lus10001176 locus=Lus10001176.g ID=Lus10001176.BGIv1.0 annot-version=v1.0 ATGGAAGAACAAGAGGAAGAGGAATACGAGGTGAGAAGAGAGCTAACCGACGGCGAGTGCCAGGGGAGGCTATCGTCGACGACAAGCGAGGAATCGGAGG TGGACTACTGGCCGTTTCAAGGGAACATGTTCCAGAGCCCCGATTGCTTCGACACCGGATACATCTCTGACGAGGAAAGCCTGATTGAGATTGCACTTCC AGGCGGGGAATTCGTTCGTCACCCAACTCCGATGAGCTGCAAAGGTGGTGAGTTCGGGATTCGGAGCTCGTATTTCAAGCAGATGATGATTGAGGAGGAT AACCTGATCGAGATTGACATTTCAATTGGATCGATTAAATCAACTCCTAGGTTCGGGATTCAAGCTTCTTAA
AA sequence Show only first row Show all	>Lus10001176 pacid=23155041 polypeptide=Lus10001176 locus=Lus10001176.g ID=Lus10001176.BGIv1.0 annot-version=v1.0 MEEQEEEEYEVRRELTDGECQGRLSSTTSEESEVDYWPFQGNMFQSPDCFDTGYISDEESLIEIALPGGEFVRHPTPMSCKGGEFGIRSSYFKQMMIEED NLIEIDISIGSIKSTPRFGIQAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35870			unknown protein		Lus10001176 [exp]	0	1
AT5G53130		ATCNGC1, CNGC1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Lus10038308 [exp]	5.0	0.6904
AT5G46090			Protein of unknown function (D...		Lus10013971 [exp]	13.3	0.6859
AT1G08500		AtENODL18	early nodulin-like protein 18 ...		Lus10009231 [exp]	19.4	0.6512
AT5G66650			Protein of unknown function (D...		Lus10005312 [exp]	21.2	0.6350
AT1G19090		CRK1, RKF2	CYSTEINE-RICH RLK \(RECEPTOR-L...		Lus10033389 [exp]	28.9	0.5597
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042903 [exp]	31.6	0.6599
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10022866 [exp]	36.7	0.6497
AT1G05385		Psb27-H1, LPA19	LOW PSII ACCUMULATION 19, phot...		Lus10010561 [exp]	47.9	0.6405
AT5G51750		ATSBT1.3	subtilase 1.3 (.1)		Lus10018720 [exp]	53.2	0.6115
AT4G26590		ATOPT5	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10022313 [exp]	56.5	0.6163

Compare expression of checked genes

Lus10001176 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.