Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000297 [exp] 185 / 8e-63 ND / Lus10002333 [exp] 62 / 1e-14 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001189 pacid=23161996 polypeptide=Lus10001189 locus=Lus10001189.g ID=Lus10001189.BGIv1.0 annot-version=v1.0 ATGTTCCTCTCCCTTACGGTCGAGCTACTTCGTGCCTCTCCGTGGGAATGCATGGCCATTGGAATCCCAGCTCTCTTTCCTGCGGATGTCAGTTGCTCTC AGGACAAGAAGCACGGGAATCCCAATGAGATGGCGGCGACAACCAAGCCCTCAAGAGAGCTTCAATCCTTGCTCTCTGTAAAGACCCTATTAAGTAATCC CGAATGTGTCACCCGGGGCGGCTTTCTCCCGGATAGTGAATTGGGAGAAGACCGTCCTCCGTCTTTCATGTAG
AA sequence Show only first row Show all	>Lus10001189 pacid=23161996 polypeptide=Lus10001189 locus=Lus10001189.g ID=Lus10001189.BGIv1.0 annot-version=v1.0 MFLSLTVELLRASPWECMAIGIPALFPADVSCSQDKKHGNPNEMAATTKPSRELQSLLSVKTLLSNPECVTRGGFLPDSELGEDRPPSFM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10001189 [exp]	0	1
					Lus10000297 [exp]	1.0	1.0000
					Lus10009498 [exp]	6.0	0.9371
AT3G12440			Polynucleotidyl transferase, r...		Lus10000103 [exp]	8.4	0.9473
AT2G07820			unknown protein		Lus10015035 [exp]	9.8	0.9402
AT5G24350			unknown protein		Lus10007768 [exp]	12.2	0.9271
ATCG01280		ATCG01280.1, YC...	Chloroplast Ycf2;ATPase, AAA t...		Lus10002548 [exp]	12.3	0.9244
ATCG00500		ATCG00500.1, AC...	acetyl-CoA carboxylase carboxy...		Lus10002473 [exp]	13.7	0.9098
					Lus10004082 [exp]	18.5	0.9237
AT3G19450		CAD-C, ATCAD4	CINNAMYL ALCOHOL DEHYDROGENASE...		Lus10003787 [exp]	19.0	0.8397
ATMG00080		ATMG00080.1, RP...	ribosomal protein L16 (.1)		Lus10004083 [exp]	24.7	0.9214

Compare expression of checked genes

Lus10001189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.