Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07230 146 / 8e-43 NPC1 non-specific phospholipase C1 (.1) AT3G03540 142 / 2e-41 NPC5 non-specific phospholipase C5 (.1) AT2G26870 141 / 6e-41 NPC2 non-specific phospholipase C2 (.1) AT3G03530 139 / 7e-40 NPC4 non-specific phospholipase C4 (.1) AT3G03520 127 / 6e-36 NPC3 non-specific phospholipase C3 (.1) AT3G48610 127 / 1e-35 NPC6 non-specific phospholipase C6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005860 [exp] 197 / 4e-62 AT1G07230 810 / 0.0 non-specific phospholipase C1 (.1) Lus10040678 [exp] 181 / 6e-56 AT1G07230 809 / 0.0 non-specific phospholipase C1 (.1) Lus10028492 [exp] 143 / 1e-41 AT3G03530 689 / 0.0 non-specific phospholipase C4 (.1) Lus10009153 [exp] 137 / 3e-39 AT3G03530 694 / 0.0 non-specific phospholipase C4 (.1) Lus10025726 [exp] 133 / 5e-38 AT3G48610 774 / 0.0 non-specific phospholipase C6 (.1) Lus10035935 [exp] 131 / 5e-37 AT3G48610 773 / 0.0 non-specific phospholipase C6 (.1) Lus10009690 [exp] 122 / 7e-35 AT2G26870 258 / 9e-82 non-specific phospholipase C2 (.1) Lus10036038 [exp] 87 / 7e-22 AT2G26870 423 / 1e-147 non-specific phospholipase C2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G250500 [exp] 159 / 1e-47 AT1G07230 820 / 0.0 non-specific phospholipase C1 (.1) Potri.009G045100 [exp] 154 / 1e-45 AT1G07230 815 / 0.0 non-specific phospholipase C1 (.1) Potri.009G069900 [exp] 144 / 5e-42 AT2G26870 786 / 0.0 non-specific phospholipase C2 (.1) Potri.013G073600 [exp] 142 / 2e-41 AT3G03530 709 / 0.0 non-specific phospholipase C4 (.1) Potri.001G275500 [exp] 136 / 4e-39 AT2G26870 769 / 0.0 non-specific phospholipase C2 (.1) Potri.012G099300 [exp] 130 / 8e-37 AT3G48610 834 / 0.0 non-specific phospholipase C6 (.1) Potri.015G097900 [exp] 125 / 4e-35 AT3G48610 813 / 0.0 non-specific phospholipase C6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0088 [flax] [poplar] Alk_phosphatase PF04185 [flax] [poplar] Phosphoesterase Phosphoesterase family
Representative CDS sequence Show only first row Show all	>Lus10001207 pacid=23173052 polypeptide=Lus10001207 locus=Lus10001207.g ID=Lus10001207.BGIv1.0 annot-version=v1.0 ATGCTTGCATTTGCTGATTGCTTATTATTTTCTAAAACAATCTTCGACTCTCTCGACGGGAGTGGGCTCAGCTTTGGGATTTATTACCAAAGTATTCCCG CCACTCTCTTCTTCAACTCGCTAAGGAAGCTGAAGAACGTCTTCAAATTTCATAGCTACGAGCTCAGTTTCAAGTCCCACGCGACGAAAGGCAAGCTACC GAATTACGTTGTCGTCGAGCAAAGGTGGTATGATGTGCCGTTTGGGCTAGCCAACGACGACCGCCCTTCTCACGACGTGTCGGAAGGGCAGAAGTTCGTC AAGGAGGTTTACGAGGTGTTGAGAGCTAGCCCATAG
AA sequence Show only first row Show all	>Lus10001207 pacid=23173052 polypeptide=Lus10001207 locus=Lus10001207.g ID=Lus10001207.BGIv1.0 annot-version=v1.0 MLAFADCLLFSKTIFDSLDGSGLSFGIYYQSIPATLFFNSLRKLKNVFKFHSYELSFKSHATKGKLPNYVVVEQRWYDVPFGLANDDRPSHDVSEGQKFV KEVYEVLRASP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07230		NPC1	non-specific phospholipase C1 ...		Lus10001207 [exp]	0	1
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10025620 [exp]	1.0	0.9491
AT3G18060			transducin family protein / WD...		Lus10032444 [exp]	8.8	0.8775
AT3G52520			unknown protein		Lus10004216 [exp]	11.8	0.8733
AT1G07230		NPC1	non-specific phospholipase C1 ...		Lus10001208 [exp]	17.3	0.8090
AT4G19170		CCD4, NCED4	carotenoid cleavage dioxygenas...		Lus10037286 [exp]	18.2	0.8223
					Lus10014719 [exp]	19.3	0.8752
AT5G06920		FLA21	FASCICLIN-like arabinogalactan...		Lus10020296 [exp]	21.7	0.8587
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10041966 [exp]	23.0	0.8734
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10004214 [exp]	23.8	0.8109
AT3G61230	LIM	PLIM2c	PLIM2c, GATA type zinc finger ...		Lus10029859 [exp]	25.3	0.8610

Compare expression of checked genes

Lus10001207 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.