Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44710 121 / 3e-37 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038399 [exp] 170 / 2e-56 AT5G44710 149 / 5e-48 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G155000 [exp] 127 / 2e-39 AT5G44710 113 / 4e-34 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08293 [flax] [poplar] MRP-S33 Mitochondrial ribosomal subunit S27
Representative CDS sequence Show only first row Show all	>Lus10001221 pacid=23148481 polypeptide=Lus10001221 locus=Lus10001221.g ID=Lus10001221.BGIv1.0 annot-version=v1.0 ATGAGCGGCGGCGGAATCCTGAGGAAGCTCCTGGAAACAGCCGTGAGCCAAGGAGTTACAGACGCTAGAGCGAAGATATTCGGCCATGTTCTGAATCCAA CAGGCCAGAGATCTCCCCACAAGTTACTCAGGAAGAAGCTCATCGGCGAGAAGGTTGCCGGATGGTACCCTCACGACATCACCAAGGACGACCCTCTCAT CATGGCTGCCAAACAACAAGAACGGCTGTCGAAGCTCGAGATGCTGAAACGTCGTGGGAAAGGTCCTCCTAAGAAGGGCCAAGGCAAGGGTGCTACCAAG CGTAACAAAAGCAAATAG
AA sequence Show only first row Show all	>Lus10001221 pacid=23148481 polypeptide=Lus10001221 locus=Lus10001221.g ID=Lus10001221.BGIv1.0 annot-version=v1.0 MSGGGILRKLLETAVSQGVTDARAKIFGHVLNPTGQRSPHKLLRKKLIGEKVAGWYPHDITKDDPLIMAAKQQERLSKLEMLKRRGKGPPKKGQGKGATK RNKSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G44710			unknown protein		Lus10001221 [exp]	0	1
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041513 [exp]	6.3	0.7379
AT1G11930			Predicted pyridoxal phosphate-...		Lus10015557 [exp]	6.7	0.7074
AT1G30475			unknown protein		Lus10027131 [exp]	7.2	0.7296
AT5G13470			unknown protein		Lus10005318 [exp]	9.2	0.6994
AT5G40570			Surfeit locus protein 2 (SURF2...		Lus10003658 [exp]	9.4	0.7229
AT1G01170			Protein of unknown function (D...		Lus10042373 [exp]	10.5	0.7264
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Lus10038868 [exp]	15.9	0.6813
AT5G63690			Nucleic acid-binding, OB-fold-...		Lus10035799 [exp]	16.1	0.6806
AT2G01818			PLATZ transcription factor fam...		Lus10013242 [exp]	23.0	0.6024
AT3G62370			heme binding (.1)		Lus10023692 [exp]	25.3	0.6425

Compare expression of checked genes

Lus10001221 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.