Lus10001222 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10001222 pacid=23148488 polypeptide=Lus10001222 locus=Lus10001222.g ID=Lus10001222.BGIv1.0 annot-version=v1.0
ATGCATTGGAAAGGAGAAAAGGACTGTGAAGGTGTACCAATGCAGACTTTTCCCTCTTGGATACCGACTTACTATCAGTTCCTCAGTTACCAATACAGAC
TTTTTCCTCTTGGATATGCCGAGCCCGAGCGGACTGTGGTCATCAGTCAATCAAGTTCTTGCAACGTGCGATGCTGCTACCCATTAAATAAACCTCATAC
TTCTGAAAGGCATAGACCTCTATATCGGAAAGTTCGGTTGCTAAAAGGTACAGACATGGTGTACTGTACTAATGGATGCAGGACAAACAACCCAACTGGC
ACCAGAGCCAGGATTCATCTACCAGAACTATTTTCAGGATTGTGGATTATTGATACCGTTACTTTGAATGTGAACAATCGCAAGGTGAAGAAACACCATC
GAGCAATCAATCTCGATGATAACTCAACTGCCACATTAGCGCTTAACGAAATTATTGATAGAGTTCGACAGAAAATGTAA
AA sequence
>Lus10001222 pacid=23148488 polypeptide=Lus10001222 locus=Lus10001222.g ID=Lus10001222.BGIv1.0 annot-version=v1.0
MHWKGEKDCEGVPMQTFPSWIPTYYQFLSYQYRLFPLGYAEPERTVVISQSSSCNVRCCYPLNKPHTSERHRPLYRKVRLLKGTDMVYCTNGCRTNNPTG
TRARIHLPELFSGLWIIDTVTLNVNNRKVKKHHRAINLDDNSTATLALNEIIDRVRQKM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001222 0 1
AT1G18260 HRD3A, EBS5 EMS-mutagenized bri1 suppresso... Lus10009047 5.4 0.9085
AT1G69010 bHLH bHLH102, BIM2 BES1-interacting Myc-like prot... Lus10005091 7.3 0.9021
AT1G15200 protein-protein interaction re... Lus10023800 10.0 0.9055
AT1G76480 unknown protein Lus10006035 10.4 0.9014
Lus10014678 13.9 0.8948
AT1G11330 S-locus lectin protein kinase ... Lus10015422 16.7 0.8808
AT5G06350 ARM repeat superfamily protein... Lus10004194 19.3 0.8600
AT2G26990 COP12, ATCSN2, ... FUSCA 12, CONSTITUTIVE PHOTOMO... Lus10041295 21.3 0.8867
AT1G30140 unknown protein Lus10024751 23.0 0.8984
Lus10019353 23.1 0.8662

Lus10001222 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.