Lus10001223 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64320 49 / 2e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G40400 48 / 2e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G37230 44 / 7e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12775 43 / 0.0001 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63130 43 / 0.0001 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G18020 43 / 0.0001 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G19890 40 / 0.0008 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038398 433 / 5e-156 AT4G20090 52 / 2e-07 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10022861 46 / 1e-05 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10024962 45 / 3e-05 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10018567 45 / 4e-05 AT1G03560 862 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10015113 45 / 4e-05 AT1G09900 364 / 5e-119 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10039056 44 / 6e-05 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040633 44 / 0.0001 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10017675 42 / 0.0004 AT1G06270 397 / 1e-138 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038974 41 / 0.0008 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G075700 244 / 2e-81 AT4G20090 65 / 7e-12 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G050500 50 / 8e-07 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G045000 45 / 2e-05 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G015900 44 / 4e-05 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G050240 44 / 7e-05 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.019G043101 44 / 8e-05 AT5G14770 796 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G013300 42 / 0.0002 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.011G057900 42 / 0.0003 AT5G46100 627 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G139200 40 / 0.001 AT1G52620 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10001223 pacid=23148478 polypeptide=Lus10001223 locus=Lus10001223.g ID=Lus10001223.BGIv1.0 annot-version=v1.0
ATGAATTCATTGAGACAGTGCCACCACCTACGATCTCTGACCTTCCTTTCGAGATCGATCACCTCCTTCCGAGTTTTACAGCATGGAGAATCAACAGCCT
TTACCAACACACAACCAACAACGCTCACCAACGAAGAGATAACCAAAATCAACCTCCTAATCCCACGGCTATGCATCGTCTCCGAGAACCTCCCCACAGC
AATCCACCTCATAACAACAGCACTCCTCACGAACCCACCTCCAAAGTCCTTATCTTTATCCATCTTCATCCACTCCCTCACCTCAGAGCCTGACATGGCC
AAACCCATGTCACTCCTCACAGTTCTAAGGCACAACCCATCTGCACATTCCTACCAGAGCCCCATCGCATCATTGCTCATCTCCTCTTACTTGAAAAGAA
ATCGACCCAAAGAGGCACTGAAAGTGTATCACTGGATGGTTAGGCCTGGCTCTCTTTGTAAAGTGGAGAAGACTGTCTATGGGATTTGGCTTTATGGGCT
TTGCAAGCTAGGGTTGGCTTTTGAATCCTTGAAGATTTTGAAGGACATGATGGGTGTGGGAGTTATTCCTGGGGATGGATTGAGGAAGATGGTTGTGAGG
AACTTGCTGTGGGAAGCTAGAGTTACTGAGGCAGTTGAGCTTGATGCTGCCTTGAGTGGCTGCTGCATTGATGGTGAGGGTTTTGAGAAATTGATGAGTC
TTTTAGATTCTTTGGCTGAGAATTGGAGAGACTAG
AA sequence
>Lus10001223 pacid=23148478 polypeptide=Lus10001223 locus=Lus10001223.g ID=Lus10001223.BGIv1.0 annot-version=v1.0
MNSLRQCHHLRSLTFLSRSITSFRVLQHGESTAFTNTQPTTLTNEEITKINLLIPRLCIVSENLPTAIHLITTALLTNPPPKSLSLSIFIHSLTSEPDMA
KPMSLLTVLRHNPSAHSYQSPIASLLISSYLKRNRPKEALKVYHWMVRPGSLCKVEKTVYGIWLYGLCKLGLAFESLKILKDMMGVGVIPGDGLRKMVVR
NLLWEARVTEAVELDAALSGCCIDGEGFEKLMSLLDSLAENWRD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G20090 EMB1025 embryo defective 1025, Pentatr... Lus10001223 0 1
AT4G03500 Ankyrin repeat family protein ... Lus10026833 2.2 0.8553
AT1G03670 ankyrin repeat family protein ... Lus10020209 4.6 0.8488
AT1G55200 Protein kinase protein with ad... Lus10041608 4.7 0.8810
Lus10019353 5.1 0.8762
AT3G14640 CYP72A10 "cytochrome P450, family 72, s... Lus10019354 10.2 0.7880
AT3G18215 Protein of unknown function, D... Lus10009640 12.0 0.8616
AT1G04945 HIT-type Zinc finger family pr... Lus10008703 13.7 0.8138
AT1G15910 FDM1 factor of DNA methylation 1, X... Lus10006221 17.1 0.8129
AT1G76480 unknown protein Lus10006035 21.0 0.8607
AT1G15910 FDM1 factor of DNA methylation 1, X... Lus10036870 21.0 0.8479

Lus10001223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.