Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038397 [exp] 117 / 3e-35 ND 38 / 3e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G155400 [exp] 50 / 1e-08 AT1G30880 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001224 pacid=23148482 polypeptide=Lus10001224 locus=Lus10001224.g ID=Lus10001224.BGIv1.0 annot-version=v1.0 ATGGGGAAATCCATCAGATCGAAGCGGGAGAAGAGGCTGAGAGCCATCAGAAGGGACCTTGTCACGCCCTATTACGACAAGAAAGATGAAGCCAAGATCG CCGCCATTGAAGCAGCGCTCGCCGCTCCTAAGCTGGAAGTCAGACCTTCGCCGTTCGCCACCACTTCGTCCATGGATACATCCACCGTCAATATCATCGA TAATACCACCTCAAACGCCAATCCTGGAGCTGATGTTGAGATGGCGGTCGACGGGGATGGGGAGAAGTCGAAGAAGCCATTGGGGAGAAAGCTTAGGAAG AAATTGAAGCTTGCGAAGAACAAGCGCGGCGGGAAGAAGGGTAACATCAAGAAGAGACGTTAG
AA sequence Show only first row Show all	>Lus10001224 pacid=23148482 polypeptide=Lus10001224 locus=Lus10001224.g ID=Lus10001224.BGIv1.0 annot-version=v1.0 MGKSIRSKREKRLRAIRRDLVTPYYDKKDEAKIAAIEAALAAPKLEVRPSPFATTSSMDTSTVNIIDNTTSNANPGADVEMAVDGDGEKSKKPLGRKLRK KLKLAKNKRGGKKGNIKKRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G30880			unknown protein		Lus10001224 [exp]	0	1
AT1G09590			Translation protein SH3-like f...		Lus10021079 [exp]	2.4	0.8695
AT4G15000			Ribosomal L27e protein family ...		Lus10027314 [exp]	4.0	0.8670
AT2G31610			Ribosomal protein S3 family pr...		Lus10033442 [exp]	5.5	0.8613
AT5G62440			Protein of unknown function (D...		Lus10021669 [exp]	7.7	0.8401
AT5G27120			NOP56-like pre RNA processing ...		Lus10018995 [exp]	9.5	0.8320
AT3G13580			Ribosomal protein L30/L7 famil...		Lus10016970 [exp]	9.8	0.8562
AT3G58660			Ribosomal protein L1p/L10e fam...		Lus10024134 [exp]	10.5	0.8075
AT5G59240			Ribosomal protein S8e family p...		Lus10025887 [exp]	11.2	0.8551
AT3G13580			Ribosomal protein L30/L7 famil...		Lus10021296 [exp]	12.1	0.8435
AT4G15000			Ribosomal L27e protein family ...		Lus10010461 [exp]	12.3	0.8424

Compare expression of checked genes

Lus10001224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.