Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G22070 102 / 3e-26 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G33350 99 / 4e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G01030 97 / 1e-24 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G26782 95 / 1e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09410 94 / 2e-23 pentatricopeptide (PPR) repeat-containing protein (.1) AT5G04780 94 / 3e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G44880 93 / 3e-23 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G21065 93 / 4e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G15930 93 / 5e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G20230 92 / 8e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038396 [exp] 214 / 5e-69 AT5G66520 286 / 2e-90 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10016425 [exp] 105 / 2e-27 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10030053 [exp] 98 / 1e-24 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029853 [exp] 96 / 4e-24 AT1G09190 575 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10033026 [exp] 96 / 4e-24 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029436 [exp] 95 / 1e-23 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014298 [exp] 95 / 1e-23 AT5G66520 748 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026006 [exp] 94 / 2e-23 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013341 [exp] 93 / 6e-23 AT1G05750 525 / 0.0 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G155600 [exp] 162 / 2e-49 AT5G66520 306 / 3e-98 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G031600 [exp] 107 / 3e-28 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G369900 [exp] 105 / 2e-27 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G103600 [exp] 103 / 9e-27 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G012600 [exp] 101 / 5e-26 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G085500 [exp] 97 / 1e-24 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.014G012500 [exp] 97 / 1e-24 AT3G49710 995 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G223900 [exp] 96 / 3e-24 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G001000 [exp] 96 / 6e-24 AT4G21065 793 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.014G068800 [exp] 96 / 7e-24 AT2G45350 735 / 0.0 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10001225 pacid=23148480 polypeptide=Lus10001225 locus=Lus10001225.g ID=Lus10001225.BGIv1.0 annot-version=v1.0 ATGACTAAAGAGGAGAATGGTTTGGAGCGTAGGATTCAGCACTATGGATGCATGGTTGATCTGTACGGCAGGGCAGGGCTAGTGGAAGAAGCTCATGATG TTATCACGAGAATGGAGCTCGAGCCGAATTCTGCTGTTTGGGGATCGTTTCTGTCAGCTTGTAAGAAGCATGGTAGGTTTGATATGGCTGAGAAGGTGAT GGAGCAGGTGTTGAGAATTGTGAAGCCAGAGACTGATGGAGGGATATACAGTCAGATGTGTGATTTGTATGTTGCAAATGATCAATGGGAGGATGCGGAA AGAGTCAGGAAACTGATGGTGAATCGGAGAGTTAGGGGCAGTAGCTTTGTTGGAATGGAAGCAGACTGA
AA sequence Show only first row Show all	>Lus10001225 pacid=23148480 polypeptide=Lus10001225 locus=Lus10001225.g ID=Lus10001225.BGIv1.0 annot-version=v1.0 MTKEENGLERRIQHYGCMVDLYGRAGLVEEAHDVITRMELEPNSAVWGSFLSACKKHGRFDMAEKVMEQVLRIVKPETDGGIYSQMCDLYVANDQWEDAE RVRKLMVNRRVRGSSFVGMEAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G22070			pentatricopeptide (PPR) repeat...		Lus10001225 [exp]	0	1
					Lus10002240 [exp]	5.8	0.7064
AT4G17810	C2H2ZnF	ZFP12	C2H2 and C2HC zinc fingers sup...		Lus10004578 [exp]	6.1	0.7132
					Lus10006537 [exp]	6.6	0.6629
AT1G27880			DEAD/DEAH box RNA helicase fam...		Lus10015818 [exp]	10.8	0.5729
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Lus10037227 [exp]	12.6	0.6420
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023904 [exp]	13.3	0.6839
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Lus10022285 [exp]	15.4	0.6839
					Lus10010383 [exp]	17.2	0.6839
					Lus10039435 [exp]	18.7	0.6498
					Lus10000380 [exp]	18.8	0.6839

Compare expression of checked genes

Lus10001225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.