Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63030 171 / 2e-56 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1) AT5G40370 152 / 5e-49 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2) AT2G20270 96 / 6e-26 Thioredoxin superfamily protein (.1.2) AT1G77370 91 / 1e-24 Glutaredoxin family protein (.1) AT5G20500 89 / 1e-23 Glutaredoxin family protein (.1) AT4G28730 88 / 5e-23 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1) AT5G18600 74 / 2e-18 Thioredoxin superfamily protein (.1) AT1G03020 69 / 2e-16 Thioredoxin superfamily protein (.1) AT3G62930 69 / 4e-16 Thioredoxin superfamily protein (.1) AT4G15670 69 / 4e-16 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042104 [exp] 236 / 3e-82 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10022253 [exp] 147 / 3e-47 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10013089 [exp] 146 / 7e-47 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10017148 [exp] 94 / 1e-25 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10021590 [exp] 94 / 2e-25 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1) Lus10022844 [exp] 91 / 7e-24 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10028355 [exp] 82 / 2e-21 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1) Lus10011333 [exp] 79 / 2e-19 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10038514 [exp] 77 / 4e-19 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G078900 [exp] 174 / 1e-57 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.012G082800 [exp] 163 / 2e-53 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.001G347700 [exp] 141 / 8e-45 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2) Potri.002G254100 [exp] 98 / 1e-26 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1) Potri.018G133400 [exp] 89 / 9e-24 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Potri.007G017300 [exp] 86 / 2e-22 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1) Potri.001G060600 [exp] 82 / 3e-21 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 81 / 8e-21 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 76 / 1e-18 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 74 / 2e-18 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10001237 pacid=23166291 polypeptide=Lus10001237 locus=Lus10001237.g ID=Lus10001237.BGIv1.0 annot-version=v1.0 ATGAGCGAACAAGAAATGGATGCTGCGCTTAACAAGGCCAAGGAGATTTCCAAGTCCGCTCCTGTGGTTGTATTCAGCAAAACGTACTGTGGGTTCTGCA CGAGGGTGAAGCAGCTGCTGACCCAGCTTGGAGCTGCTTTCAAAGTCATCGAATTGGACAAAGAAGGTGATGGAGACGAGATTCAAGGAGCGTTATTGAA ATGGACGGGACAGAGGACAGTGCCTAATGTGTTCATTGGAGGAAAGCATATTGGTGGCTGTGACGCTACGTTGGCAAAGCACCAAAAGGGAGAGCTGCTT CCTCTTCTCACCGAGGTTGGCGCCGTAGCAAACAACTCAGCTCAGCTTTGA
AA sequence Show only first row Show all	>Lus10001237 pacid=23166291 polypeptide=Lus10001237 locus=Lus10001237.g ID=Lus10001237.BGIv1.0 annot-version=v1.0 MSEQEMDAALNKAKEISKSAPVVVFSKTYCGFCTRVKQLLTQLGAAFKVIELDKEGDGDEIQGALLKWTGQRTVPNVFIGGKHIGGCDATLAKHQKGELL PLLTEVGAVANNSAQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Lus10001237 [exp]	0	1
AT5G11500			unknown protein		Lus10037899 [exp]	2.0	0.9315
AT5G11970			Protein of unknown function (D...		Lus10021581 [exp]	3.5	0.9097
AT4G08230			glycine-rich protein (.1.2)		Lus10041619 [exp]	3.9	0.9134
AT1G16810			unknown protein		Lus10034837 [exp]	4.9	0.9129
AT1G56700			Peptidase C15, pyroglutamyl pe...		Lus10001521 [exp]	6.3	0.9298
AT1G15270			Translation machinery associat...		Lus10037543 [exp]	6.7	0.9069
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10002228 [exp]	7.5	0.9080
AT3G61440		ATCYSC1, ARATH;...	BETA-SUBSTITUTED ALA SYNTHASE ...		Lus10014765 [exp]	8.0	0.8919
AT2G41430		LSR1, CID1, ERD...	CTC-Interacting Domain 1, dehy...		Lus10042014 [exp]	9.5	0.9103
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10010764 [exp]	9.5	0.9011

Compare expression of checked genes

Lus10001237 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.