Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39260 43 / 3e-07 ATGRP8, CCR1, GR-RBP8 glycine-rich RNA-binding protein 8, GLYCINE-RICH PROTEIN 8, cold, circadian rhythm, and RNA binding 1 (.1.2.3.4) AT2G21660 42 / 3e-06 CCR2, ATGRP7, GR-RBP7 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) AT3G26420 39 / 3e-05 ATRZ-1A RZ-1A, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1) AT4G13850 35 / 0.0004 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT5G54580 35 / 0.0007 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042321 [exp] 67 / 6e-16 AT2G21660 121 / 2e-36 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Lus10026343 [exp] 62 / 6e-14 AT4G39260 145 / 1e-45 glycine-rich RNA-binding protein 8, GLYCINE-RICH PROTEIN 8, cold, circadian rhythm, and RNA binding 1 (.1.2.3.4) Lus10040454 [exp] 52 / 7e-10 AT2G21660 148 / 3e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Lus10026344 [exp] 49 / 4e-09 AT2G21660 140 / 3e-44 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Lus10042320 [exp] 49 / 4e-09 AT2G21660 140 / 3e-44 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Lus10023569 [exp] 48 / 2e-08 AT2G21660 147 / 8e-46 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Lus10003980 [exp] 40 / 1e-05 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023758 [exp] 40 / 1e-05 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014802 [exp] 39 / 5e-05 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G155300 [exp] 44 / 4e-07 AT2G21660 145 / 3e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Potri.009G116400 [exp] 44 / 6e-07 AT2G21660 145 / 5e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Potri.001G207100 [exp] 41 / 6e-06 AT3G26420 175 / 7e-55 RZ-1A, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1) Potri.001G409800 [exp] 36 / 0.0003 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.011G130300 [exp] 35 / 0.0008 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10001242 pacid=23166293 polypeptide=Lus10001242 locus=Lus10001242.g ID=Lus10001242.BGIv1.0 annot-version=v1.0 ATGGCTGATGGTGAGTACAAGTGCTTCATTTATGGCCTCTCCCGGGCTACCACCGACGAAGCACTCTTTGAAGCTTTCAGAAACTTTGGCGATATCGCTG AATCGAAGGTCCGTTTGTCACCTGTGATCTCCAAGCGATCGGATCTCACCCGACTCCGCTAA
AA sequence Show only first row Show all	>Lus10001242 pacid=23166293 polypeptide=Lus10001242 locus=Lus10001242.g ID=Lus10001242.BGIv1.0 annot-version=v1.0 MADGEYKCFIYGLSRATTDEALFEAFRNFGDIAESKVRLSPVISKRSDLTRLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39260		ATGRP8, CCR1, G...	glycine-rich RNA-binding prote...		Lus10001242 [exp]	0	1
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10021452 [exp]	4.7	0.9040
AT5G15080			Protein kinase superfamily pro...		Lus10030796 [exp]	7.4	0.8824
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10021619 [exp]	9.9	0.8776
AT4G10810			unknown protein		Lus10010114 [exp]	11.0	0.8702
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10014359 [exp]	12.7	0.9109
AT2G23950			Leucine-rich repeat protein ki...		Lus10015484 [exp]	13.0	0.8682
AT1G23220			Dynein light chain type 1 fami...		Lus10021793 [exp]	14.2	0.8940
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10016110 [exp]	14.7	0.8810
AT3G22810			Plant protein of unknown funct...		Lus10009509 [exp]	15.5	0.8629
AT1G21090			Cupredoxin superfamily protein...		Lus10028576 [exp]	16.5	0.8628

Compare expression of checked genes

Lus10001242 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.