Lus10001254 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05570 79 / 6e-18 transducin family protein / WD-40 repeat family protein (.1.2)
AT4G35560 41 / 0.0001 DAW1 DUO1-activated WD40 1, Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002478 148 / 6e-47 AT5G05570 73 / 3e-16 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10027810 105 / 2e-29 AT5G05570 84 / 2e-19 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10009082 88 / 7e-21 AT5G05570 358 / 6e-106 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10037841 63 / 4e-12 AT5G05570 1009 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10030399 63 / 4e-12 AT5G05570 977 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10005040 45 / 1e-06 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G117800 97 / 5e-24 AT5G05570 900 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.006G101600 88 / 3e-23 AT5G05570 72 / 8e-16 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.016G117700 80 / 3e-20 AT5G05570 90 / 3e-22 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.010G187700 79 / 1e-17 AT5G05570 1069 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.008G069700 63 / 2e-12 AT5G05570 624 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.005G101600 44 / 2e-05 AT4G35560 1037 / 0.0 DUO1-activated WD40 1, Transducin/WD40 repeat-like superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10001254 pacid=23166955 polypeptide=Lus10001254 locus=Lus10001254.g ID=Lus10001254.BGIv1.0 annot-version=v1.0
ATGTTCTGCGGCTGTCTTTCTGAGTCTCAATCTTACAAGAGCCCTTCGCCGGTGGCAAAAGCATCATCATCATCCCATGGTAAGAAAAACACGATGATCG
CCAGAAAACTTCAGATGATTCTTCTGTTACGTTTACTCCATCAATTTGATCAAATGGGGTTTTTTCTCTGTACAGAAAGGGCAAAGCTTTTAGGTTCAAA
AGGTGCAATAAGGCCTAAACCAATGAATCCAGACGCAATCAGATCCAAGTATAGAAAATCTGCTAATGTGAAGTCAGCGGCTGCACATGCAAAGAACAAG
CTGGTAGAGAGGAAAGAAAAGCTTGAGAAAATCAGTCTGCGGTCAGCGGAGCTGGAAGGAAGAGCACAAGACTATGCATCAATGGCAAAGGAGCTTGCTG
ACATAATGGAGAAGAGGAAGAAATGGTGGCAACTGTGA
AA sequence
>Lus10001254 pacid=23166955 polypeptide=Lus10001254 locus=Lus10001254.g ID=Lus10001254.BGIv1.0 annot-version=v1.0
MFCGCLSESQSYKSPSPVAKASSSSHGKKNTMIARKLQMILLLRLLHQFDQMGFFLCTERAKLLGSKGAIRPKPMNPDAIRSKYRKSANVKSAAAHAKNK
LVERKEKLEKISLRSAELEGRAQDYASMAKELADIMEKRKKWWQL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05570 transducin family protein / WD... Lus10001254 0 1
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Lus10018138 2.0 0.9458
AT1G13890 ATSNAP30, SNAP3... soluble N-ethylmaleimide-sensi... Lus10026653 4.2 0.9202
AT5G62670 AHA11 H\(+\)-ATPase 11, H\(+\)-ATPas... Lus10028203 4.7 0.9327
Lus10004778 5.2 0.9292
AT3G54070 Ankyrin repeat family protein ... Lus10038357 5.3 0.9287
AT2G44290 Bifunctional inhibitor/lipid-t... Lus10033076 5.5 0.9230
AT2G22560 Kinase interacting (KIP1-like)... Lus10002655 6.5 0.9029
AT2G45910 U-box domain-containing protei... Lus10018835 7.0 0.9114
AT1G79400 ATCHX2 cation/H+ exchanger 2, cation/... Lus10026156 8.0 0.8976
AT1G43900 Protein phosphatase 2C family ... Lus10042775 9.4 0.8331

Lus10001254 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.