Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18210 41 / 3e-05 Calcium-binding EF-hand family protein (.1.2) AT1G73630 41 / 4e-05 EF hand calcium-binding protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024718 [exp] 116 / 1e-34 ND 40 / 9e-05 Lus10031345 [exp] 62 / 6e-13 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2) Lus10009059 [exp] 61 / 3e-12 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10018012 [exp] 53 / 2e-09 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10042008 [exp] 51 / 4e-09 AT1G18210 138 / 1e-42 Calcium-binding EF-hand family protein (.1.2) Lus10027081 [exp] 39 / 0.0002 AT1G18210 131 / 2e-39 Calcium-binding EF-hand family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G048200 [exp] 43 / 9e-06 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.015G039500 [exp] 42 / 1e-05 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001257 pacid=23166956 polypeptide=Lus10001257 locus=Lus10001257.g ID=Lus10001257.BGIv1.0 annot-version=v1.0 ATGGGATCCAACTACTCTCCTTTTGACCTGCAGCGCGCCATGGACGACATCGACACCGATAAGGACGGGTTCATCAACTTGGAGGAGTACCCGAGCTCGG CCGCTCGTCTTCCGGAGCTTCCGTGGCGGCAGAGCTTCACAAGGCGTCTTTATCTCCTAGAATCGATCCATCTTTCTCCCAGAATAGATATCCCATCTTC CATCTTTGATCCATCTTCATCTCCCAGAATCGATCCATCTTCATCTCACAGAATCGATCCATCTTTGGTCCCGCCGTTGCCGTGTACTTCCCGTCGGACT GGGATTAGGTCATCGTTGACGGCGGCGGAGGATCCGACGGCGGGCGGAGGAGGATGA
AA sequence Show only first row Show all	>Lus10001257 pacid=23166956 polypeptide=Lus10001257 locus=Lus10001257.g ID=Lus10001257.BGIv1.0 annot-version=v1.0 MGSNYSPFDLQRAMDDIDTDKDGFINLEEYPSSAARLPELPWRQSFTRRLYLLESIHLSPRIDIPSSIFDPSSSPRIDPSSSHRIDPSLVPPLPCTSRRT GIRSSLTAAEDPTAGGGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10001257 [exp]	0	1
AT1G74830			Protein of unknown function, D...		Lus10036656 [exp]	1.4	0.8941
AT5G59700			Protein kinase superfamily pro...		Lus10020474 [exp]	2.4	0.8544
AT1G20500			AMP-dependent synthetase and l...		Lus10020473 [exp]	5.5	0.8351
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Lus10007503 [exp]	5.5	0.8033
AT1G29380			Carbohydrate-binding X8 domain...		Lus10025379 [exp]	6.2	0.8483
					Lus10036302 [exp]	6.9	0.7554
AT1G80940			unknown protein		Lus10041624 [exp]	7.5	0.8270
AT1G01040		SIN1, EMB76, EM...	SHORT INTEGUMENTS 1, EMBRYO DE...		Lus10005141 [exp]	8.4	0.8037
AT1G03390			HXXXD-type acyl-transferase fa...		Lus10033079 [exp]	8.8	0.8320
AT2G31730	bHLH		basic helix-loop-helix (bHLH) ...		Lus10024071 [exp]	10.4	0.8481

Compare expression of checked genes

Lus10001257 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.