Lus10001281 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17050 62 / 9e-11 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT3G51560 59 / 1e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT4G16860 56 / 8e-09 RPP5, RPP4 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT1G69550 56 / 1e-08 disease resistance protein (TIR-NBS-LRR class) (.1)
AT5G46520 55 / 2e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G46510 55 / 2e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G45250 52 / 2e-07 RPS4 RESISTANT TO P. SYRINGAE 4, Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G22690 50 / 6e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G46260 50 / 1e-06 disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G44480 50 / 1e-06 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042778 244 / 4e-76 AT4G12010 185 / 1e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10024150 204 / 9e-61 AT1G69550 186 / 9e-49 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10001537 182 / 5e-53 AT5G44510 175 / 1e-45 target of AVRB operation1 (.1)
Lus10015648 183 / 3e-52 AT4G12010 420 / 1e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10010223 178 / 9e-51 AT5G17680 218 / 6e-58 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10017420 167 / 9e-48 AT1G69550 164 / 1e-42 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10017418 152 / 2e-41 AT5G44510 335 / 1e-96 target of AVRB operation1 (.1)
Lus10015649 137 / 1e-39 AT1G69550 75 / 1e-15 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10010221 132 / 1e-34 AT5G17680 369 / 4e-109 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G069200 70 / 2e-13 AT5G17680 590 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.005G031101 62 / 7e-11 AT5G17680 557 / 8e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G001971 62 / 1e-10 AT5G36930 427 / 3e-130 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G068300 61 / 2e-10 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G068200 61 / 2e-10 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.T009323 61 / 3e-10 AT5G36930 449 / 2e-138 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.003G014200 57 / 5e-09 AT5G36930 673 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G070700 57 / 6e-09 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G016425 56 / 1e-08 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T001500 55 / 2e-08 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Representative CDS sequence
>Lus10001281 pacid=23166378 polypeptide=Lus10001281 locus=Lus10001281.g ID=Lus10001281.BGIv1.0 annot-version=v1.0
ATGTACACCTCTGCATATGCTAAGGTGAAGCATCTAATTGATAGAACCCTCTTAATTTGTGAAGGAAAGAATATCCAAGTGCATGGTCTGCTTAAGGAAC
CGAAGTGGGGAAACGCAGCAGCCATAGAAATGGTGCTTCCGAAAAGGAAAAAAGCCAAAGTGGTAGACATTCCTTGGATTGGCAGTAATCCAAGCTTCAA
ATGCCTGCCATCTAGCATCAGCAATACCAGTTCTCTCAAGTCGCTTAATTTCAAAAAGACTTCGAGTATTCTCGAATTGACGAGCCTTTACTCAATTGAT
GTGAGCTACTGCAAGCGTTTCGAGTCAATGCCCACGGGTATCCATAAGCTTTCCAAGTTACGACGATTGGTAGTGTCCGGCTGTGACCGCATTCGATCTC
TGCCACAACTCCCACCAAATCTGACAGAATTGTATGTAAATGGTTGCAAGTCTTTACAAGCTCTATCAAGCAACACAGGTAAGCTGTTGCATCTGAATAA
ACTCTATTCTGAAGAATGCCCGCAATTGGGACAGACTATACCTGTCGAAATTTTGGCAAACTTCCTCGTTCATGCCAGCTTGTCTCCGGCACCTTGTGTG
ATGTACTGGGAAGTTGTATGTTCAAGAAGCGAGCTTCCGGAATGGTTAACGTACAAAAGCATGAACACGATGAAGGAGGAGGGTTGCAGTGTAGAGGTGC
AGTTGCCTCTTCCCAGCGACCGTGACCAACCAATGATTATGAACGGAATTGCATTCGCCGCTGTGTTTCCTTGCAACTCGATGGTGGAAATGAAATGA
AA sequence
>Lus10001281 pacid=23166378 polypeptide=Lus10001281 locus=Lus10001281.g ID=Lus10001281.BGIv1.0 annot-version=v1.0
MYTSAYAKVKHLIDRTLLICEGKNIQVHGLLKEPKWGNAAAIEMVLPKRKKAKVVDIPWIGSNPSFKCLPSSISNTSSLKSLNFKKTSSILELTSLYSID
VSYCKRFESMPTGIHKLSKLRRLVVSGCDRIRSLPQLPPNLTELYVNGCKSLQALSSNTGKLLHLNKLYSEECPQLGQTIPVEILANFLVHASLSPAPCV
MYWEVVCSRSELPEWLTYKSMNTMKEEGCSVEVQLPLPSDRDQPMIMNGIAFAAVFPCNSMVEMK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69550 disease resistance protein (TI... Lus10001281 0 1

Lus10001281 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.