Lus10001288 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22570 118 / 2e-32 Major facilitator superfamily protein (.1)
AT1G22550 116 / 8e-32 Major facilitator superfamily protein (.1)
AT1G72125 116 / 9e-32 Major facilitator superfamily protein (.1)
AT1G72120 109 / 3e-29 Major facilitator superfamily protein (.1)
AT1G22540 107 / 1e-28 Major facilitator superfamily protein (.1)
AT1G72140 90 / 3e-22 Major facilitator superfamily protein (.1)
AT1G62200 87 / 3e-21 AtPTR6 peptide transporter 6, Major facilitator superfamily protein (.1)
AT2G02040 85 / 2e-20 NTR1, ATPTR2-B NITRATE TRANSPORTER 1, ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2, peptide transporter 2 (.1)
AT1G72130 82 / 1e-19 Major facilitator superfamily protein (.1.2)
AT2G40460 82 / 2e-19 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009462 166 / 4e-50 AT1G22540 580 / 0.0 Major facilitator superfamily protein (.1)
Lus10016932 108 / 1e-28 AT1G22540 673 / 0.0 Major facilitator superfamily protein (.1)
Lus10008252 100 / 4e-26 AT1G22540 641 / 0.0 Major facilitator superfamily protein (.1)
Lus10024156 94 / 1e-23 AT3G54450 593 / 0.0 Major facilitator superfamily protein (.1)
Lus10039521 89 / 7e-22 AT3G54450 612 / 0.0 Major facilitator superfamily protein (.1)
Lus10040698 86 / 1e-20 AT5G01180 709 / 0.0 ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 5, peptide transporter 5 (.1)
Lus10011055 86 / 1e-20 AT2G02040 847 / 0.0 NITRATE TRANSPORTER 1, ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2, peptide transporter 2 (.1)
Lus10000670 85 / 2e-20 AT2G02040 849 / 0.0 NITRATE TRANSPORTER 1, ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2, peptide transporter 2 (.1)
Lus10018207 85 / 2e-20 AT5G01180 818 / 0.0 ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 5, peptide transporter 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G106600 119 / 1e-32 AT1G22540 666 / 0.0 Major facilitator superfamily protein (.1)
Potri.013G107050 115 / 2e-31 AT1G22540 670 / 0.0 Major facilitator superfamily protein (.1)
Potri.013G106500 114 / 6e-31 AT1G22540 644 / 0.0 Major facilitator superfamily protein (.1)
Potri.019G079551 113 / 1e-30 AT1G22540 662 / 0.0 Major facilitator superfamily protein (.1)
Potri.013G106700 108 / 9e-29 AT1G22540 612 / 0.0 Major facilitator superfamily protein (.1)
Potri.013G106400 107 / 2e-28 AT1G22540 632 / 0.0 Major facilitator superfamily protein (.1)
Potri.013G106925 105 / 5e-28 AT1G22540 605 / 0.0 Major facilitator superfamily protein (.1)
Potri.019G079700 104 / 2e-27 AT1G22540 547 / 0.0 Major facilitator superfamily protein (.1)
Potri.019G079600 102 / 7e-27 AT1G22540 632 / 0.0 Major facilitator superfamily protein (.1)
Potri.T124706 87 / 3e-21 AT3G54450 662 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00854 PTR2 POT family
Representative CDS sequence
>Lus10001288 pacid=23166383 polypeptide=Lus10001288 locus=Lus10001288.g ID=Lus10001288.BGIv1.0 annot-version=v1.0
ATGTCCATACAAACAACAAACTCGAAAGAGATAGGGCAAGGAGGGCACAAGCCTTGCGTGCAGGCATTCGAAGCTGACCAATTCGACGAGCACAGCTCGA
AAGAGATAGAGCAAAGATCCTCGTTCTTCAACTGGTGGTACTGTAGCATGGCGATTGGGGTCAACGTGGCACTTCTTGTAGTGGTGTACGTTCAAGACAA
CTTGAATTGGGCTGTTGGGTTTGCAATCCCTTGCTTGACCATGCTTGCTAGTCTTGCCACTTTCTTGCTTGGCAGGACGACTTACAGGTTCAGCATAAAC
GGAAAGAGGACATAA
AA sequence
>Lus10001288 pacid=23166383 polypeptide=Lus10001288 locus=Lus10001288.g ID=Lus10001288.BGIv1.0 annot-version=v1.0
MSIQTTNSKEIGQGGHKPCVQAFEADQFDEHSSKEIEQRSSFFNWWYCSMAIGVNVALLVVVYVQDNLNWAVGFAIPCLTMLASLATFLLGRTTYRFSIN
GKRT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G72125 Major facilitator superfamily ... Lus10001288 0 1
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10029379 1.4 0.8577
Lus10034545 4.7 0.8018
AT1G29430 SAUR-like auxin-responsive pro... Lus10007059 5.7 0.8018
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10016168 6.6 0.8018
AT4G16195 Plant self-incompatibility pro... Lus10017929 7.4 0.8018
AT5G67090 Subtilisin-like serine endopep... Lus10002044 8.1 0.8018
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Lus10025872 10.6 0.7555
AT1G08790 Protein of unknown function (D... Lus10042536 10.6 0.7209
AT3G08720 ATPK2, ATPK19, ... ARABIDOPSIS THALIANA SERINE/TH... Lus10022732 11.0 0.6823
AT5G08020 ATRPA70B ARABIDOPSIS THALIANA RPA70-KDA... Lus10042979 13.5 0.6390

Lus10001288 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.