Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30320 197 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 185 / 8e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 184 / 1e-59 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 161 / 8e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 158 / 1e-49 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 154 / 5e-48 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 153 / 6e-48 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 149 / 4e-46 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G02730 146 / 1e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33730 144 / 2e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006980 [exp] 286 / 2e-100 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 222 / 2e-74 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 215 / 1e-71 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10005557 [exp] 162 / 3e-51 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 162 / 4e-51 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006981 [exp] 151 / 1e-46 AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020493 [exp] 147 / 2e-45 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 147 / 2e-45 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020491 [exp] 144 / 2e-44 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G096007 [exp] 212 / 6e-71 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 209 / 6e-70 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G007000 [exp] 160 / 1e-50 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 157 / 1e-49 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 156 / 5e-49 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 149 / 2e-46 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 147 / 2e-45 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 140 / 5e-43 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096028 [exp] 139 / 1e-41 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288301 [exp] 135 / 6e-41 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10001319 pacid=23169302 polypeptide=Lus10001319 locus=Lus10001319.g ID=Lus10001319.BGIv1.0 annot-version=v1.0 ATGCACTCTCCCTCCATCATCATCTTCATCCTCCTCGTCGCGGTGGCCGCGTCAGCTCGTGGCGCGACCCTCCCTTCCGCCCTAGCAAGAAGACGAGCCT ACACGATCATCGCCGCGAGATTCATGGGCCCACAGAACGCTGCTAGGGCAGCACTGAAAATGCCGCCCTTAAAATGGGACGCCGGGCTGGCCCGGTTCGC ACAGAGGTACGCGAACCGGAGGAAGCAGGACTGCGCCCTGGTCCACTCGGGCGGGCCCTACGGGGAGAACATATTCTGGGGGAGCGGGAGCCGGTGGACC CCGGCGCAGGCTGCGGCAGCTTGGACGGACGAGAAGAAGTCGTACAGGTACTGGTCGAACTCGTGCGCGGGGAACGCTGAGTGCGGCCACTACACGCAGA TCGTGTGGAGGCATACGAAGCGGGTCGGGTGCGCCCGGATCGTTTGTAATGGCGGGAAGGGTGTTTTTATGACTTGTAATTATGACCCGCCGGGGAATTA CGACGGGGAGAGACCTTATTGA
AA sequence Show only first row Show all	>Lus10001319 pacid=23169302 polypeptide=Lus10001319 locus=Lus10001319.g ID=Lus10001319.BGIv1.0 annot-version=v1.0 MHSPSIIIFILLVAVAASARGATLPSALARRRAYTIIAARFMGPQNAARAALKMPPLKWDAGLARFAQRYANRRKQDCALVHSGGPYGENIFWGSGSRWT PAQAAAAWTDEKKSYRYWSNSCAGNAECGHYTQIVWRHTKRVGCARIVCNGGKGVFMTCNYDPPGNYDGERPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10001319 [exp]	0	1
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10006980 [exp]	1.7	0.9538
AT5G45580	GARP		Homeodomain-like superfamily p...		Lus10010404 [exp]	4.2	0.9522
AT3G44220			Late embryogenesis abundant (L...		Lus10043410 [exp]	5.0	0.9618
AT1G20190		ATHEXPALPHA1.14...	EXPANSIN 11, expansin 11 (.1)		Lus10034548 [exp]	7.4	0.9533
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10011746 [exp]	8.1	0.9554
AT2G26490			Transducin/WD40 repeat-like su...		Lus10011655 [exp]	9.9	0.9434
AT2G47270	bHLH	bHLH151, UPB1	UPBEAT1, sequence-specific DNA...		Lus10010001 [exp]	13.1	0.9536
					Lus10038634 [exp]	15.8	0.9324
AT4G12730		FLA2	FASCICLIN-like arabinogalactan...		Lus10001178 [exp]	16.1	0.9439
AT4G12730		FLA2	FASCICLIN-like arabinogalactan...		Lus10001752 [exp]	17.5	0.9510

Compare expression of checked genes

Lus10001319 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.