Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013632 [exp] 67 / 2e-15 AT5G17840 111 / 9e-31 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10031340 [exp] 38 / 3e-05 ND 34 / 0.002
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G066600 [exp] 44 / 2e-07 AT3G47510 40 / 2e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001325 pacid=23146556 polypeptide=Lus10001325 locus=Lus10001325.g ID=Lus10001325.BGIv1.0 annot-version=v1.0 ATGGATATTGGTTCAAACAGAGGAAGCCCGTCTTCATCAGTTTCTTCCGCGCCAACGGAAGTCCATCTTCCTCAGGTGCAGGAAGATGAAGAAATTGGGG AATGTTATATGATGAGTTTGGAAAGAAGGATGGAGATGGAGGAGAGCACAGATTACCCAGGGACTGGTGCAAATAATCACCATGATCCTAAAACTCCTGG AAGACCATTTTGA
AA sequence Show only first row Show all	>Lus10001325 pacid=23146556 polypeptide=Lus10001325 locus=Lus10001325.g ID=Lus10001325.BGIv1.0 annot-version=v1.0 MDIGSNRGSPSSSVSSAPTEVHLPQVQEDEEIGECYMMSLERRMEMEESTDYPGTGANNHHDPKTPGRPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10001325 [exp]	0	1
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Lus10017209 [exp]	8.9	0.7742
AT1G24160			unknown protein		Lus10029213 [exp]	12.3	0.7333
AT3G09880		ATB' BETA, ATB'...	Protein phosphatase 2A regulat...		Lus10021511 [exp]	14.8	0.7453
AT1G69550			disease resistance protein (TI...		Lus10024150 [exp]	15.2	0.6523
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10017263 [exp]	17.7	0.6960
AT5G02020		SIS	Salt Induced Serine rich, unkn...		Lus10021101 [exp]	20.0	0.7450
AT5G14490	NAC	ANAC085	NAC domain containing protein ...		Lus10003668 [exp]	25.2	0.7132
AT1G15740			Leucine-rich repeat family pro...		Lus10025751 [exp]	26.6	0.7285
AT3G62950			Thioredoxin superfamily protei...		Lus10005938 [exp]	27.0	0.6561
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10009876 [exp]	28.6	0.7130

Compare expression of checked genes

Lus10001325 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.