Lus10001341 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17540 205 / 3e-65 HXXXD-type acyl-transferase family protein (.1)
AT3G03480 184 / 4e-57 CHAT acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase (.1)
AT3G48720 88 / 3e-21 DCF DEFICIENT IN CUTIN FERULATE, HXXXD-type acyl-transferase family protein (.1)
AT5G63560 88 / 5e-21 HXXXD-type acyl-transferase family protein (.1)
AT5G41040 84 / 2e-19 HXXXD-type acyl-transferase family protein (.1.2)
AT1G03390 80 / 5e-18 HXXXD-type acyl-transferase family protein (.1)
AT2G19070 78 / 2e-17 SHT spermidine hydroxycinnamoyl transferase (.1)
AT1G27620 78 / 2e-17 HXXXD-type acyl-transferase family protein (.1)
AT5G57840 77 / 3e-17 HXXXD-type acyl-transferase family protein (.1)
AT5G48930 75 / 2e-16 HCT hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026872 271 / 8e-93 AT5G17540 341 / 2e-115 HXXXD-type acyl-transferase family protein (.1)
Lus10005663 236 / 1e-79 AT5G17540 295 / 4e-98 HXXXD-type acyl-transferase family protein (.1)
Lus10020331 242 / 2e-79 AT5G17540 504 / 4e-177 HXXXD-type acyl-transferase family protein (.1)
Lus10020332 229 / 2e-74 AT5G17540 464 / 3e-161 HXXXD-type acyl-transferase family protein (.1)
Lus10020330 228 / 1e-73 AT5G17540 436 / 2e-150 HXXXD-type acyl-transferase family protein (.1)
Lus10005660 227 / 2e-73 AT5G17540 461 / 4e-160 HXXXD-type acyl-transferase family protein (.1)
Lus10005659 208 / 2e-66 AT5G17540 406 / 6e-139 HXXXD-type acyl-transferase family protein (.1)
Lus10005661 151 / 9e-45 AT5G17540 412 / 7e-142 HXXXD-type acyl-transferase family protein (.1)
Lus10032554 92 / 3e-22 AT5G41040 640 / 0.0 HXXXD-type acyl-transferase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G043600 233 / 7e-76 AT5G17540 545 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.013G074500 228 / 3e-74 AT5G17540 547 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.013G074400 228 / 7e-74 AT5G17540 518 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.013G074300 219 / 6e-71 AT5G17540 497 / 7e-175 HXXXD-type acyl-transferase family protein (.1)
Potri.019G002900 206 / 1e-65 AT5G17540 481 / 5e-168 HXXXD-type acyl-transferase family protein (.1)
Potri.019G003000 201 / 7e-64 AT5G17540 480 / 9e-168 HXXXD-type acyl-transferase family protein (.1)
Potri.003G019900 188 / 1e-58 AT5G17540 410 / 3e-140 HXXXD-type acyl-transferase family protein (.1)
Potri.001G447766 181 / 1e-58 AT5G17540 241 / 6e-78 HXXXD-type acyl-transferase family protein (.1)
Potri.001G448000 185 / 2e-57 AT5G17540 400 / 4e-136 HXXXD-type acyl-transferase family protein (.1)
Potri.011G153500 183 / 1e-56 AT5G17540 388 / 1e-131 HXXXD-type acyl-transferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0149 CoA-acyltrans PF02458 Transferase Transferase family
Representative CDS sequence
>Lus10001341 pacid=23146560 polypeptide=Lus10001341 locus=Lus10001341.g ID=Lus10001341.BGIv1.0 annot-version=v1.0
ATGTTCAAGGTCCGAAGACAAGTGCCGGAGCTGGTCCGGCCGGCCAAACCGACTCCACACGAGCTGAAGCCACTCTCCGACATCGACGACCAGGAGGGAC
TTCGATTCCACATCCCGGTGATTCAGTTCTACAACCACCGACCTTCCATGAGCGGCAAGGACCCGGCGGCGATTATCCGTACAGCACTGGCGGATACGCT
CGTGCCTTACTATCCCTTTGCTGGGCGGATGAGAGAAGGCCCTAACCGTAAGCTCATGGTGGAGTGTACCGGCGAAGGTGTTCTGTTCATCGAGGCTGAT
GCGGATGTACGGCTGGCGGATTTCGGTCACATGATTCACCCACCATTTCCATGCATTGAAGAGCTGCTGTACGATGTTCCTGGATCTAGCGCCATCCTCC
ACGCCCCACTACTGCTCATTCAGGTACAAGCAATAATTGCTTCTGTTTAG
AA sequence
>Lus10001341 pacid=23146560 polypeptide=Lus10001341 locus=Lus10001341.g ID=Lus10001341.BGIv1.0 annot-version=v1.0
MFKVRRQVPELVRPAKPTPHELKPLSDIDDQEGLRFHIPVIQFYNHRPSMSGKDPAAIIRTALADTLVPYYPFAGRMREGPNRKLMVECTGEGVLFIEAD
ADVRLADFGHMIHPPFPCIEELLYDVPGSSAILHAPLLLIQVQAIIASV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G17540 HXXXD-type acyl-transferase fa... Lus10001341 0 1
AT5G17540 HXXXD-type acyl-transferase fa... Lus10026872 2.0 0.8820
AT2G26900 BASS2 bile acid:sodium symporter fam... Lus10006672 8.7 0.8944
AT3G06980 DEA(D/H)-box RNA helicase fami... Lus10039091 9.2 0.8876
AT4G16390 SVR7 suppressor of variegation 7, p... Lus10038788 12.5 0.8891
AT4G28080 Tetratricopeptide repeat (TPR)... Lus10035822 15.3 0.8618
AT1G66430 pfkB-like carbohydrate kinase ... Lus10028517 18.3 0.8659
ATCG00670 PCLPP, ATCG0067... CASEINOLYTIC PROTEASE P 1, pla... Lus10006595 20.8 0.8625
AT1G11290 CRR22 CHLORORESPIRATORY REDUCTION22,... Lus10042924 20.9 0.8756
ATCG00830 ATCG00830.1, RP... ribosomal protein L2 (.1) Lus10001687 21.7 0.8642
AT2G24210 AtTPS10 terpene synthase 10 (.1) Lus10006355 21.9 0.8529

Lus10001341 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.