Plant FIBer expression Database

Lus10001362 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14520 164 / 3e-48 pescadillo-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000357
[exp]
250 / 3e-86 AT5G14520 180 / 2e-54 pescadillo-related (.1)
Lus10000618
[exp]
233 / 5e-74 AT5G14520 787 / 0.0 pescadillo-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G121400
[exp]
167 / 2e-49 AT5G14520 799 / 0.0 pescadillo-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06732 Pescadillo_N Pescadillo N-terminus
Representative CDS sequence
>Lus10001362 pacid=23162019 polypeptide=Lus10001362 locus=Lus10001362.g ID=Lus10001362.BGIv1.0 annot-version=v1.0
ATGTGCAACCTAGCTACATCTCTGGATGCATTGAAAGGGCATGTCAATTTTATTGTTGGCAAAGAAATTCAAAGGAGCAAGCTGAAGAAGAACAAACACT
ATAGACTTGCTCCAATTACTTACTGCTTCGTTTGTTTACTGGGGAAGAAGAAGGAAGGGAACGCTGCCCGGTACATGACCCGGTCACAGGCTATCAAGCA
GCTCCAAGTTAATCTCAACGTCTTCAGGCAGCTCTGCATTCTCAAAGGCGTGTTCCCTAGAGAACCGAAGAAGAAGGTTAGAGGGAATAACCAGACGTAC
TACCATGTCAAGGATATAAGTTTCATCCAACATGAACCCTTACTTGAGAAGTTGAGGGAAAAGAGGGCATACAGAAAGAAAATACAGAAGGCTTTGGCTA
AGAAGAACGAAGATCTAGCAACTCGTCTTCGAACGCGAGAGCCAACTTACGCATTGGACAAGCTCATTCTGGAAAGGTTTGTTAAGCCCATTCATTTATT
AGATTCCCTTTGA
AA sequence
>Lus10001362 pacid=23162019 polypeptide=Lus10001362 locus=Lus10001362.g ID=Lus10001362.BGIv1.0 annot-version=v1.0
MCNLATSLDALKGHVNFIVGKEIQRSKLKKNKHYRLAPITYCFVCLLGKKKEGNAARYMTRSQAIKQLQVNLNVFRQLCILKGVFPREPKKKVRGNNQTY
YHVKDISFIQHEPLLEKLREKRAYRKKIQKALAKKNEDLATRLRTREPTYALDKLILERFVKPIHLLDSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14520 pescadillo-related (.1) Lus10001362
[exp]
0 1
AT5G44090 Calcium-binding EF-hand family... Lus10003628
[exp]
4.0 0.9111
AT2G25850 PAPS2 poly(A) polymerase 2 (.1), pol... Lus10037589
[exp]
4.0 0.9146
AT5G12040 Nitrilase/cyanide hydratase an... Lus10025012
[exp]
4.2 0.9137
AT2G39340 AtSAC3A yeast Sac3 homolog A, SAC3/GAN... Lus10001973
[exp]
4.7 0.9166
AT3G54980 Pentatricopeptide repeat (PPR)... Lus10019524
[exp]
6.5 0.9033
AT5G58720 smr (Small MutS Related) domai... Lus10040668
[exp]
8.5 0.8776
AT2G39580 unknown protein Lus10005958
[exp]
9.8 0.8682
AT5G65540 unknown protein Lus10025712
[exp]
10.4 0.8927
AT3G06290 AtSAC3B yeast Sac3 homolog B, SAC3/GAN... Lus10012769
[exp]
13.4 0.8914
AT2G01460 P-loop containing nucleoside t... Lus10027063
[exp]
13.9 0.8946

Lus10001362 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.