Lus10001371 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G61010 204 / 6e-63 CPSF73-I cleavage and polyadenylation specificity factor 73-I (.1.2.3)
AT2G01730 66 / 4e-13 ATCPSF73-II, EDA26 embryo sac development arrest 26, cleavage and polyadenylation specificity factor 73 kDa subunit-II (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015460 66 / 4e-13 AT1G61010 940 / 0.0 cleavage and polyadenylation specificity factor 73-I (.1.2.3)
Lus10037338 66 / 6e-13 AT2G01730 732 / 0.0 embryo sac development arrest 26, cleavage and polyadenylation specificity factor 73 kDa subunit-II (.1)
Lus10035763 63 / 5e-12 AT2G01730 755 / 0.0 embryo sac development arrest 26, cleavage and polyadenylation specificity factor 73 kDa subunit-II (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G076000 211 / 5e-65 AT1G61010 1236 / 0.0 cleavage and polyadenylation specificity factor 73-I (.1.2.3)
Potri.017G076132 204 / 1e-62 AT1G61010 1237 / 0.0 cleavage and polyadenylation specificity factor 73-I (.1.2.3)
Potri.010G106200 64 / 2e-12 AT2G01730 898 / 0.0 embryo sac development arrest 26, cleavage and polyadenylation specificity factor 73 kDa subunit-II (.1)
Potri.017G076300 0 / 1 AT1G61010 1093 / 0.0 cleavage and polyadenylation specificity factor 73-I (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10001371 pacid=23170137 polypeptide=Lus10001371 locus=Lus10001371.g ID=Lus10001371.BGIv1.0 annot-version=v1.0
ATGGCTGCTGCTTCAACTGGCCAGCCAGCTTCGTCGCTCAAGAGAAAGGAGGTGACGATGACGAGAGAAGGAGATAAACTGACGATTATACCACTGGGCG
CCGGAAGCGAAGTGGGTCGCTCTTGTTGCTATATGACATTCAAGGGGAAGACTGTATTGTTTGATTGCGGGATTCATCCAGCCTACTCGGGGATGTCTGC
TTTGCCCTACTTCGATGAAATTGATCCTTCCACCATTGATACTACATTCAGAGGTAAAGTTTACATGACCCATCCAACTAAGGCGATCTACAAGTTGCTA
TTGACCGATTACGTGAAAGTCAGCAAAGTTTCGGTTGAAGACATGTTGTTTGATGAGCAAGACATAAACAACTCCATGGACAGAATTGAGGTGTTCGTGT
GCTCTATACTGGAGACTACTCTCGTGAGGAAGATAGGCATCTTCAAGCTGCTGAAATGCCAGAGTTCTCCCCTGATATATGCATAA
AA sequence
>Lus10001371 pacid=23170137 polypeptide=Lus10001371 locus=Lus10001371.g ID=Lus10001371.BGIv1.0 annot-version=v1.0
MAAASTGQPASSLKRKEVTMTREGDKLTIIPLGAGSEVGRSCCYMTFKGKTVLFDCGIHPAYSGMSALPYFDEIDPSTIDTTFRGKVYMTHPTKAIYKLL
LTDYVKVSKVSVEDMLFDEQDINNSMDRIEVFVCSILETTLVRKIGIFKLLKCQSSPLIYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G61010 CPSF73-I cleavage and polyadenylation s... Lus10001371 0 1
AT5G14520 pescadillo-related (.1) Lus10000357 2.2 0.9260
AT3G60740 TFCD, EMB133, C... TITAN 1, TUBULIN FOLDING COFAC... Lus10030293 3.5 0.9164
AT1G14650 SWAP (Suppressor-of-White-APri... Lus10025704 4.6 0.9154
AT2G02560 TIP120, HVE, ET... HEMIVENATA, CULLIN-ASSOCIATED ... Lus10042409 8.5 0.8864
AT1G63020 SMD2, PolIVa, S... SILENCING MOVEMENT DEFICIENT 2... Lus10006339 10.3 0.8663
AT3G05680 EMB2016 embryo defective 2016 (.1.2) Lus10021265 12.0 0.9020
AT3G57660 NRPA1 nuclear RNA polymerase A1 (.1) Lus10040493 13.6 0.9101
AT1G73460 Protein kinase superfamily pro... Lus10026360 13.9 0.8788
AT1G79280 AtTPR, NUA TRANSLOCATED PROMOTER REGION, ... Lus10030142 14.5 0.8910
AT1G80410 OMA, EMB2753 OMISHA, EMBRYO DEFECTIVE 2753,... Lus10011474 17.7 0.9053

Lus10001371 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.