Plant FIBer expression Database

Lus10001374 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42965 47 / 1e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G34320 40 / 0.0002 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G02650 38 / 0.001 Ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001468
[exp]
72 / 2e-15 AT4G02280 1385 / 0.0 sucrose synthase 3 (.1)
Lus10029339
[exp]
61 / 9e-12 AT2G41010 101 / 4e-25 calmodulin (CAM)-binding protein of 25 kDa (.1)
Lus10024804
[exp]
42 / 5e-05 AT5G47830 174 / 6e-53 unknown protein
Lus10021716
[exp]
40 / 5e-05 ND /
Lus10028510
[exp]
40 / 0.0002 AT5G16710 352 / 2e-120 dehydroascorbate reductase 1 (.1)
Lus10042473
[exp]
0 / 1 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G011850
[exp]
0 / 1 ND /
PFAM info
Representative CDS sequence
>Lus10001374 pacid=23170136 polypeptide=Lus10001374 locus=Lus10001374.g ID=Lus10001374.BGIv1.0 annot-version=v1.0
ATGGGGGTGGGTTCTCACAATGGTCCGGCTTCGCAGGAAATTCTACAGGCTGTGCTTCTGGCGATTCGTGACGGTCTCTCGCTGCTCCAGGTGTTTGGCT
ACAAGAAAGCGGAGGTTGAATCTGACTCTCTTGAGGCTGTTCGGCTGATCTCGATGGGGGTTGTTGCTTCCCACCCTTTGTGGGCAATCATTATGGATAT
TCGTAATATGTTGGAAAGGGAGGAGCAATACTACATCAAACATATCTTCCGAGAAGCGAATTCAGCGGCTGATTTCATAGCGAAACTCGGCCATGGCCAT
AGCCACTCGGGAGAGAAGTTTCTCCCTTCTCCTCCCGCTGGTTTAGTTGCTATCCTCAACAGGGATATGGTCGAGCTGCTGCCTGAAGCCACCTAA
AA sequence
>Lus10001374 pacid=23170136 polypeptide=Lus10001374 locus=Lus10001374.g ID=Lus10001374.BGIv1.0 annot-version=v1.0
MGVGSHNGPASQEILQAVLLAIRDGLSLLQVFGYKKAEVESDSLEAVRLISMGVVASHPLWAIIMDIRNMLEREEQYYIKHIFREANSAADFIAKLGHGH
SHSGEKFLPSPPAGLVAILNRDMVELLPEAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42965 Polynucleotidyl transferase, r... Lus10001374
[exp]
0 1
AT1G09970 RLK7, LRRXI-23 ... receptor-like kinase 7, Leucin... Lus10012462
[exp]
34.1 0.7084
AT5G60760 P-loop containing nucleoside t... Lus10016116
[exp]
45.8 0.7507
AT2G22790 unknown protein Lus10011589
[exp]
53.4 0.7096
AT1G26380 FAD-binding Berberine family p... Lus10038437
[exp]
71.4 0.7509
AT3G18290 BTS, EMB2454 embryo defective 2454, BRUTUS,... Lus10005111
[exp]
74.8 0.7285
Lus10040440
[exp]
96.9 0.7617
AT2G24860 DnaJ/Hsp40 cysteine-rich domai... Lus10020093
[exp]
97.9 0.7647
AT1G18490 Protein of unknown function (D... Lus10038962
[exp]
166.9 0.7200

Lus10001374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.