Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043004 [exp] 70 / 1e-15 ND 47 / 8e-06 Lus10018996 [exp] 67 / 5e-15 ND / Lus10026462 [exp] 62 / 4e-13 ND / Lus10017834 [exp] 59 / 2e-12 ND / Lus10008374 [exp] 59 / 4e-12 AT1G08465 84 / 9e-21 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Lus10025366 [exp] 55 / 4e-11 ND / Lus10026752 [exp] 54 / 6e-11 ND / Lus10019613 [exp] 50 / 4e-09 ND / Lus10033180 [exp] 51 / 5e-09 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001379 pacid=23170178 polypeptide=Lus10001379 locus=Lus10001379.g ID=Lus10001379.BGIv1.0 annot-version=v1.0 ATGGAGAATATACTGATCCACAAATGGAAGGGTAAAGGTATTGGACAGTCTAGTGCAGACGGTAGTCAATCACATTCTCATCTCCTAGGGAATTGTCCTA CCGCATCTAAGGCACTAGATCGTGTCCGAGCTTTGGAAGAAGAAATTTGCTTGAGGAGGGAAGAAATAACACGAGGAAAGAAACAAGTGCAAGAAGATGA AGAGGAACAAGAAGAAGATGAGGAAGATGGTTTTGATGACTACTAA
AA sequence Show only first row Show all	>Lus10001379 pacid=23170178 polypeptide=Lus10001379 locus=Lus10001379.g ID=Lus10001379.BGIv1.0 annot-version=v1.0 MENILIHKWKGKGIGQSSADGSQSHSHLLGNCPTASKALDRVRALEEEICLRREEITRGKKQVQEDEEEQEEDEEDGFDDY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10001379 [exp]	0	1
AT2G23945			Eukaryotic aspartyl protease f...		Lus10019961 [exp]	1.4	0.8704
AT5G04885			Glycosyl hydrolase family prot...		Lus10005706 [exp]	2.0	0.8527
AT5G16100			unknown protein		Lus10020810 [exp]	3.5	0.7578
AT4G22200		AKT3, AKT2/3	potassium transport 2/3 (.1)		Lus10003644 [exp]	6.9	0.8009
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	9.6	0.7816
AT4G18360			Aldolase-type TIM barrel famil...		Lus10042495 [exp]	10.4	0.7769
AT5G55690	MADS		MADS-box transcription factor ...		Lus10019819 [exp]	10.4	0.6574
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	10.7	0.7816
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008919 [exp]	11.7	0.7816
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	12.7	0.7816

Compare expression of checked genes

Lus10001379 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.