Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17280 49 / 9e-08 Phosphoglycerate mutase family protein (.1.2) AT5G64460 45 / 2e-06 Phosphoglycerate mutase family protein (.1.2.3.4.5.6.7.8)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032821 [exp] 105 / 9e-29 AT1G58280 320 / 4e-110 Phosphoglycerate mutase family protein (.1.2.3.4) Lus10007093 [exp] 52 / 6e-09 AT5G64460 422 / 8e-151 Phosphoglycerate mutase family protein (.1.2.3.4.5.6.7.8) Lus10020467 [exp] 52 / 1e-08 AT5G64460 435 / 1e-155 Phosphoglycerate mutase family protein (.1.2.3.4.5.6.7.8) Lus10032820 [exp] 42 / 2e-05 AT2G17280 233 / 7e-77 Phosphoglycerate mutase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G108500 [exp] 48 / 1e-07 AT5G64460 412 / 2e-145 Phosphoglycerate mutase family protein (.1.2.3.4.5.6.7.8) Potri.009G080300 [exp] 47 / 4e-07 AT5G64460 449 / 5e-161 Phosphoglycerate mutase family protein (.1.2.3.4.5.6.7.8) Potri.001G286000 [exp] 46 / 7e-07 AT5G64460 438 / 9e-157 Phosphoglycerate mutase family protein (.1.2.3.4.5.6.7.8) Potri.002G108600 [exp] 38 / 0.0004 AT5G64460 298 / 3e-102 Phosphoglycerate mutase family protein (.1.2.3.4.5.6.7.8)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001381 pacid=23170175 polypeptide=Lus10001381 locus=Lus10001381.g ID=Lus10001381.BGIv1.0 annot-version=v1.0 ATGGATGCAACAGGCAGTGGCAGTCCAAGTACAACTCTGTATCCATTACACCGCACGAAAGTTCTTCATTTGGGCTATGCAAACTGCCGTCTTGGAGGAG GTGTGGATCAAGTAGTCGACTCTAGTACTAATCCTCCGTTGATGGTTGCTAATGCTGGGAATAGCTCTTCCCCTCCTATTTCTAGCTTCAACTCTCCTCC ATTTGTCGCAACCGAGTTCTGCAGGGAACATTTGGTCGAAAGCGATGAAGACACACTGGTTAAGCCTGGTCAGAGAGAGACATTTGAACAAGTAGCAGCC AGAGCACTGGAATTCTTGAAATAG
AA sequence Show only first row Show all	>Lus10001381 pacid=23170175 polypeptide=Lus10001381 locus=Lus10001381.g ID=Lus10001381.BGIv1.0 annot-version=v1.0 MDATGSGSPSTTLYPLHRTKVLHLGYANCRLGGGVDQVVDSSTNPPLMVANAGNSSSPPISSFNSPPFVATEFCREHLVESDEDTLVKPGQRETFEQVAA RALEFLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G17280			Phosphoglycerate mutase family...		Lus10001381 [exp]	0	1
AT1G60670			Protein of unknown function (D...		Lus10013072 [exp]	1.7	0.8820
AT5G16020		GEX3	gamete-expressed 3 (.1)		Lus10034090 [exp]	6.9	0.8318
AT5G64560		MRS2-2, ATMGT9	magnesium transporter 9 (.1.2)		Lus10041169 [exp]	7.5	0.8149
AT5G45110		ATNPR3, NPR3	NPR1-like protein 3 (.1)		Lus10036200 [exp]	10.8	0.8251
AT5G27230			Frigida-like protein (.1)		Lus10006522 [exp]	11.2	0.8182
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10016976 [exp]	12.0	0.7765
AT2G20495			unknown protein		Lus10024909 [exp]	14.9	0.7942
AT3G58130			N-acetylglucosaminylphosphatid...		Lus10034805 [exp]	15.7	0.8016
AT1G78760			F-box/RNI-like superfamily pro...		Lus10024701 [exp]	16.9	0.8033
AT1G66980		GDPDL2, SNC4	Glycerophosphodiester phosphod...		Lus10022359 [exp]	17.7	0.7988

Compare expression of checked genes

Lus10001381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.