Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24400 313 / 4e-107 ATCIPK8, PKS11, CIPK8, SnRK3.13 SNF1-RELATED PROTEIN KINASE 3.13, PROTEIN KINASE 11, CBL-interacting protein kinase 8 (.1.2) AT5G35410 281 / 1e-94 ATSOS2, CIPK24, SOS2, SnRK3.11 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) AT2G26980 263 / 4e-88 CIPK3, SnRK3.17 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) AT5G21326 258 / 1e-85 Ca2+regulated serine-threonine protein kinase family protein (.1) AT1G30270 254 / 2e-83 PKS17, ATCIPK23, SnRK3.23, LKS1, CIPK23 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) AT1G01140 246 / 1e-80 PKS6, CIPK9, SnRK3.12 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) AT5G21222 230 / 2e-71 protein kinase family protein (.1) AT5G45820 217 / 2e-69 PKS18, CIPK20, SnRK3.6 SNF1-RELATED PROTEIN KINASE 3.6, PROTEIN KINASE 18, CBL-interacting protein kinase 20 (.1) AT1G48260 212 / 1e-67 CIPK17, SnRK3.21 SNF1-RELATED PROTEIN KINASE 3.21, CBL-interacting protein kinase 17 (.1) AT3G17510 210 / 1e-66 CIPK1, SnRK3.16 SNF1-RELATED PROTEIN KINASE 3.16, CBL-interacting protein kinase 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032822 [exp] 348 / 2e-120 AT4G24400 738 / 0.0 SNF1-RELATED PROTEIN KINASE 3.13, PROTEIN KINASE 11, CBL-interacting protein kinase 8 (.1.2) Lus10019411 [exp] 288 / 6e-97 AT5G35410 729 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Lus10002692 [exp] 260 / 6e-86 AT1G01140 709 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) Lus10030210 [exp] 259 / 6e-86 AT1G01140 709 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) Lus10028115 [exp] 259 / 1e-85 AT1G30270 793 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Lus10042816 [exp] 259 / 2e-85 AT1G30270 794 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Lus10024448 [exp] 212 / 3e-67 AT5G25110 654 / 0.0 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1) Lus10036280 [exp] 210 / 7e-67 AT4G30960 662 / 0.0 SNF1-RELATED PROTEIN KINASE 3.14, CBL-INTERACTING PROTEIN KINASE 6, SOS3-interacting protein 3 (.1) Lus10014163 [exp] 211 / 1e-66 AT5G58380 592 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G130500 [exp] 286 / 2e-96 AT5G35410 711 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Potri.006G068400 [exp] 286 / 3e-96 AT5G35410 686 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Potri.001G222600 [exp] 262 / 5e-87 AT2G26980 752 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Potri.006G062800 [exp] 261 / 2e-86 AT1G30270 753 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Potri.009G021000 [exp] 255 / 4e-84 AT2G26980 753 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Potri.014G104200 [exp] 253 / 3e-83 AT1G01140 688 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) Potri.018G119200 [exp] 253 / 5e-83 AT1G30270 749 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Potri.002G177900 [exp] 251 / 1e-82 AT1G01140 711 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) Potri.010G002500 [exp] 227 / 3e-73 AT3G17510 631 / 0.0 SNF1-RELATED PROTEIN KINASE 3.16, CBL-interacting protein kinase 1 (.1.2) Potri.002G109000 [exp] 227 / 3e-73 AT4G24400 652 / 0.0 SNF1-RELATED PROTEIN KINASE 3.13, PROTEIN KINASE 11, CBL-interacting protein kinase 8 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10001382 pacid=23170177 polypeptide=Lus10001382 locus=Lus10001382.g ID=Lus10001382.BGIv1.0 annot-version=v1.0 ATGGTGGTGAGGAAAGTTGGCAAGTATGAGGTCGGGAGAACAATTGGGGAAGGAACATTTGCAAAGGTGAAGTTCGCTCAGAACACTGAGACTGGCGAGA GTGTGGCCATGAAAGTACTGGATCGCAGCACCATCTTCAAGCACAAGATGGTTGATCAGATCAAGAGGGAGATATCTATAATGAAACTTGTCAGGCATCC TAATGTTTTAGCCAGCCGTTCCAAGATCTACATAATCTTGGAGTTCATTACAGGTAGTGAATTGTTTGATAAAATAGTTCATCATGGAAGGCTGAGTGAG GCTAAAGCTAGAAGATACTTTCAACAGCTTATAGATGGTGTGGACTATTGTCATAGTAAAGGAGTTTATCACAGGGATCTGAAGCCGGAAAATCTTTTGC TTGATTCACAAGGAAATTTAAAGATCTATGACTTTGGTCTAAGTGCACTGCCCCCTCAAGGAGTTACCTTGCTACGAACAACTTGTGGGACTCCTAACTA TGTTGCACCAGAGAGCCCCATCCTGATACATGCTTCCGCATAA
AA sequence Show only first row Show all	>Lus10001382 pacid=23170177 polypeptide=Lus10001382 locus=Lus10001382.g ID=Lus10001382.BGIv1.0 annot-version=v1.0 MVVRKVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSTIFKHKMVDQIKREISIMKLVRHPNVLASRSKIYIILEFITGSELFDKIVHHGRLSE AKARRYFQQLIDGVDYCHSKGVYHRDLKPENLLLDSQGNLKIYDFGLSALPPQGVTLLRTTCGTPNYVAPESPILIHASA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G24400		ATCIPK8, PKS11,...	SNF1-RELATED PROTEIN KINASE 3....		Lus10001382 [exp]	0	1

Compare expression of checked genes

Lus10001382 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.