Lus10001398 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09870 71 / 1e-16 SAUR-like auxin-responsive protein family (.1)
AT2G28085 49 / 8e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023012 246 / 4e-85 AT3G09870 97 / 5e-27 SAUR-like auxin-responsive protein family (.1)
Lus10004014 145 / 2e-45 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10030263 137 / 2e-42 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10013819 134 / 4e-41 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10026531 130 / 2e-39 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Lus10001397 66 / 2e-14 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10026532 60 / 3e-12 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10023011 55 / 1e-10 AT3G09870 59 / 1e-12 SAUR-like auxin-responsive protein family (.1)
Lus10021436 56 / 2e-10 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G125100 110 / 6e-32 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.016G092400 109 / 2e-31 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.010G226400 59 / 5e-12 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 44 / 5e-06 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 42 / 1e-05 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 40 / 0.0001 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10001398 pacid=23169878 polypeptide=Lus10001398 locus=Lus10001398.g ID=Lus10001398.BGIv1.0 annot-version=v1.0
ATGCCTTTGGATTCGCAGACATTCATAACCATGTTGAACAAGGAAGAGAGCATCCAAGGCTTGGTGATGCTCAAGCTTTTCACTAGGAAGGTGCAAAGGG
CTCTACTGCACAAGGCATCCAGAAGGGGGCAGAACCTGAAATGCATTCCAGAGTTAGAAGAAGACAAGGAGTCCAGGAAAGTTGTTCCAAACGATGTGAA
GAAAGGGCAGTTTGCCGTCACTGCAATCAAAGATGGGAAAGCAAAGAGGTTCACTGTAAAGTTGGATTACCTGAATGATCCAGAGTTCTTGAGTTTGCTG
GAACTGGCTGAAGAGGAATTTGGGTTCCGACAGGAAGGCGTTCTTGCTGTCCCTTGTCACCCTGAGGAGCTTCAGAAGATTCTACGAGGAGGGAAAATGA
GAAGAACAAGTACTGATCGGGGGAAAATGAGGAGAACAAGTACAGATTGGTAG
AA sequence
>Lus10001398 pacid=23169878 polypeptide=Lus10001398 locus=Lus10001398.g ID=Lus10001398.BGIv1.0 annot-version=v1.0
MPLDSQTFITMLNKEESIQGLVMLKLFTRKVQRALLHKASRRGQNLKCIPELEEDKESRKVVPNDVKKGQFAVTAIKDGKAKRFTVKLDYLNDPEFLSLL
ELAEEEFGFRQEGVLAVPCHPEELQKILRGGKMRRTSTDRGKMRRTSTDW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09870 SAUR-like auxin-responsive pro... Lus10001398 0 1
AT3G09870 SAUR-like auxin-responsive pro... Lus10023012 7.3 0.8231
AT3G58070 C2H2ZnF GIS GLABROUS INFLORESCENCE STEMS, ... Lus10017229 9.2 0.8533
AT1G72970 HTH, EDA17 HOTHEAD, embryo sac developmen... Lus10015623 10.6 0.8310
AT1G04620 HCAR 7-hydroxymethyl chlorophyll a ... Lus10043145 10.7 0.8789
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10007634 13.4 0.8353
AT4G34190 SEP1 stress enhanced protein 1 (.1) Lus10014093 13.4 0.8614
AT5G25880 ATNADP-ME3 Arabidopsis thaliana NADP-mali... Lus10006037 14.4 0.8514
AT5G16030 unknown protein Lus10033537 14.7 0.8506
AT3G24503 ALDH1A, REF1, A... REDUCED EPIDERMAL FLUORESCENCE... Lus10023626 18.2 0.8368
AT3G12080 EMB2738 embryo defective 2738, GTP-bin... Lus10002557 25.4 0.8313

Lus10001398 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.