Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09860 115 / 5e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023014 [exp] 110 / 9e-33 AT3G09860 86 / 3e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G092100 [exp] 120 / 4e-37 AT3G09860 174 / 2e-58 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001400 pacid=23169891 polypeptide=Lus10001400 locus=Lus10001400.g ID=Lus10001400.BGIv1.0 annot-version=v1.0 ATGGAGAAGTACTTTGGAAATGCGTACAGAGGCGACCCTGGAGTTCCGCATGCGAAGCCGGCCCGGTTCTGGAACATATGGATAGGCTCTGCTACTTTCT CAGCTCTCACTTGGTTCAATCCCTACCTTTGGCACTTCAACAACGAATTCAATTGGCATGACAGGGCATTCTTGCATGAGCAGTACCTCTGGAAGAAAGC AAGGGCCGAGAACAAGCCCTACAAGTCCCATGTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAACC CACACAAGTCCCCTTTAA
AA sequence Show only first row Show all	>Lus10001400 pacid=23169891 polypeptide=Lus10001400 locus=Lus10001400.g ID=Lus10001400.BGIv1.0 annot-version=v1.0 MEKYFGNAYRGDPGVPHAKPARFWNIWIGSATFSALTWFNPYLWHFNNEFNWHDRAFLHEQYLWKKARAENKPYKSHVXXXXXXXXXXXXXXXXXXXXTT HTSPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09860			unknown protein		Lus10001400 [exp]	0	1
AT2G28230			TATA-binding related factor (T...		Lus10030654 [exp]	1.4	0.9100
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10013733 [exp]	2.4	0.8971
AT2G41530		ATSFGH	ARABIDOPSIS THALIANA S-FORMYLG...		Lus10042038 [exp]	2.4	0.8949
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10041349 [exp]	2.8	0.8696
AT5G01075			Glycosyl hydrolase family 35 p...		Lus10018699 [exp]	3.0	0.8607
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Lus10023466 [exp]	3.2	0.8807
AT1G80270		PPR596	PENTATRICOPEPTIDE REPEAT 596 (...		Lus10031004 [exp]	3.7	0.8768
AT2G28230			TATA-binding related factor (T...		Lus10030830 [exp]	4.9	0.8789
AT4G15950		RDM2, NRPE4, NR...	RNA-DIRECTED DNA METHYLATION 2...		Lus10038766 [exp]	5.7	0.8850
AT1G69960		PP2A	serine/threonine protein phosp...		Lus10004252 [exp]	8.1	0.8462

Compare expression of checked genes

Lus10001400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.