Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03340 100 / 5e-26 ATPase, AAA-type, CDC48 protein (.1) AT3G09840 97 / 5e-25 ATCDC48, CDC48A, CDC48 cell division cycle 48 (.1) AT3G53230 86 / 3e-21 ATPase, AAA-type, CDC48 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041332 [exp] 94 / 2e-25 AT5G03340 312 / 3e-102 ATPase, AAA-type, CDC48 protein (.1) Lus10037385 [exp] 93 / 1e-23 AT5G03340 1501 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Lus10023018 [exp] 89 / 3e-22 AT5G03340 1419 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Lus10021442 [exp] 89 / 3e-22 AT5G03340 1520 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Lus10016123 [exp] 89 / 4e-22 AT5G03340 1526 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Lus10016124 [exp] 87 / 2e-21 AT5G03340 1511 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Lus10021441 [exp] 87 / 2e-21 AT5G03340 1529 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G080600 [exp] 96 / 7e-25 AT5G03340 1455 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Potri.012G088200 [exp] 92 / 3e-23 AT5G03340 1459 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Potri.016G091600 [exp] 88 / 6e-22 AT3G53230 1484 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Potri.006G125500 [exp] 88 / 8e-22 AT5G03340 1496 / 0.0 ATPase, AAA-type, CDC48 protein (.1) Potri.017G108200 [exp] 77 / 5e-18 AT5G03340 1311 / 0.0 ATPase, AAA-type, CDC48 protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001403 pacid=23169879 polypeptide=Lus10001403 locus=Lus10001403.g ID=Lus10001403.BGIv1.0 annot-version=v1.0 ATGGGGGAAGACGAGGTTGAAGGCGAGGTTGCTGAAATCAAGGCTGCACACTTCGAGGAATCGATGAAGTATGCTAGAAGAAGTGTGAGTGATGCGGATA TCCGCAAGTACCAAGCATTTGCTCAGACTCTTCAGCAGTCGAGAGGGTTTCGATCTGAGTTCAGGTTCTCCGAAACTAGCGGTGGAGCTGGTGGTACTTC ATCCGATCCATTTGCAACTTCTGCTGCTGCTGCTGATGATGAAGATGACCTCTATAGTTAA
AA sequence Show only first row Show all	>Lus10001403 pacid=23169879 polypeptide=Lus10001403 locus=Lus10001403.g ID=Lus10001403.BGIv1.0 annot-version=v1.0 MGEDEVEGEVAEIKAAHFEESMKYARRSVSDADIRKYQAFAQTLQQSRGFRSEFRFSETSGGAGGTSSDPFATSAAAADDEDDLYS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09840		ATCDC48, CDC48A...	cell division cycle 48 (.1)		Lus10001403 [exp]	0	1
AT2G28940			Protein kinase superfamily pro...		Lus10040804 [exp]	63.0	0.6435
AT1G26580			unknown protein		Lus10004658 [exp]	69.6	0.6370
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10036939 [exp]	74.2	0.6457
					Lus10026843 [exp]	83.1	0.6134
AT1G12440			A20/AN1-like zinc finger famil...		Lus10007015 [exp]	96.0	0.6432
AT1G07350		SR45a	serine/arginine rich-like prot...		Lus10018202 [exp]	98.5	0.6347
AT1G59960			NAD(P)-linked oxidoreductase s...		Lus10029208 [exp]	101.5	0.6308
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10004085 [exp]	109.7	0.6320
AT3G50940			P-loop containing nucleoside t...		Lus10007391 [exp]	158.4	0.6176
AT3G26100			Regulator of chromosome conden...		Lus10011399 [exp]	164.2	0.6023

Compare expression of checked genes

Lus10001403 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.