Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10340 122 / 3e-34 PAL4 phenylalanine ammonia-lyase 4 (.1) AT5G04230 117 / 1e-32 PAL3, ATPAL3 phenyl alanine ammonia-lyase 3 (.1.2) AT2G37040 115 / 1e-31 PAL1, ATPAL1 PHE ammonia lyase 1 (.1) AT3G53260 112 / 1e-30 PAL2, ATPAL2 phenylalanine ammonia-lyase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023531 [exp] 124 / 1e-34 AT2G37040 1198 / 0.0 PHE ammonia lyase 1 (.1) Lus10040416 [exp] 124 / 1e-34 AT2G37040 1194 / 0.0 PHE ammonia lyase 1 (.1) Lus10013805 [exp] 114 / 4e-31 AT2G37040 1245 / 0.0 PHE ammonia lyase 1 (.1) Lus10026518 [exp] 114 / 4e-31 AT2G37040 1256 / 0.0 PHE ammonia lyase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G224200 [exp] 123 / 1e-34 AT2G37040 1228 / 0.0 PHE ammonia lyase 1 (.1) Potri.010G224100 [exp] 123 / 2e-34 AT3G53260 1240 / 0.0 phenylalanine ammonia-lyase 2 (.1) Potri.008G038200 [exp] 122 / 4e-34 AT2G37040 1213 / 0.0 PHE ammonia lyase 1 (.1) Potri.006G126800 [exp] 112 / 2e-30 AT2G37040 1269 / 0.0 PHE ammonia lyase 1 (.1) Potri.016G091100 [exp] 111 / 2e-30 AT2G37040 1267 / 0.0 PHE ammonia lyase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00221 [flax] [poplar] Lyase_aromatic Aromatic amino acid lyase
Representative CDS sequence Show only first row Show all	>Lus10001405 pacid=23158814 polypeptide=Lus10001405 locus=Lus10001405.g ID=Lus10001405.BGIv1.0 annot-version=v1.0 ATGGACAACACTTGTTTGGTTGTCGCTTCGAATGGCAAGCTCATGTTTGAACAGTTCTCCAAGCTTGTCAACAACTTCTACAAAAACGGCCAGTCGTCGA ATTTAACAGGTGGACGCAATCCCGGCTTCAATTATGGATTCAAAGGAGCCAAAATCGCGATGGCTACATACTGCTCCGAGCTGCAATTCCTCTTGAATCC TGTGACAAACCACATACAGGGTACATAA
AA sequence Show only first row Show all	>Lus10001405 pacid=23158814 polypeptide=Lus10001405 locus=Lus10001405.g ID=Lus10001405.BGIv1.0 annot-version=v1.0 MDNTCLVVASNGKLMFEQFSKLVNNFYKNGQSSNLTGGRNPGFNYGFKGAKIAMATYCSELQFLLNPVTNHIQGT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10340		PAL4	phenylalanine ammonia-lyase 4 ...		Lus10001405 [exp]	0	1
					Lus10000977 [exp]	2.0	1.0000
AT5G04350			Plant self-incompatibility pro...		Lus10002747 [exp]	2.4	1.0000
					Lus10000363 [exp]	3.0	1.0000
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10003300 [exp]	3.2	1.0000
AT2G37890			Mitochondrial substrate carrie...		Lus10006265 [exp]	3.7	1.0000
AT1G20480			AMP-dependent synthetase and l...		Lus10011621 [exp]	4.0	1.0000
AT5G12060			Plant self-incompatibility pro...		Lus10022829 [exp]	4.5	1.0000
					Lus10027602 [exp]	4.7	1.0000
AT1G18790		AtRKD1, RKD1	RWP-RK domain containing 1, RW...		Lus10034456 [exp]	4.9	1.0000
AT4G30880			Bifunctional inhibitor/lipid-t...		Lus10019770 [exp]	5.1	1.0000

Compare expression of checked genes

Lus10001405 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.