Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1) AT2G14900 90 / 8e-25 Gibberellin-regulated family protein (.1) AT2G39540 89 / 2e-24 Gibberellin-regulated family protein (.1) AT1G74670 82 / 2e-21 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT1G10588 80 / 6e-21 Gibberellin-regulated family protein (.1.2) AT5G15230 76 / 3e-19 GASA4 GAST1 protein homolog 4 (.1.2) AT3G02885 61 / 2e-13 GASA5 GAST1 protein homolog 5 (.1) AT4G09600 61 / 2e-13 GASA3 GAST1 protein homolog 3 (.1) AT2G30810 60 / 4e-13 Gibberellin-regulated family protein (.1) AT1G22690 57 / 1e-11 Gibberellin-regulated family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024791 [exp] 94 / 2e-26 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1) Lus10018708 [exp] 91 / 3e-25 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1) Lus10029340 [exp] 76 / 4e-19 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10042012 [exp] 74 / 2e-18 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042203 [exp] 72 / 8e-18 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10004048 [exp] 72 / 8e-18 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10018016 [exp] 72 / 2e-17 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10030680 [exp] 71 / 3e-17 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10002059 [exp] 70 / 7e-17 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G020100 [exp] 98 / 4e-28 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 94 / 2e-26 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G297700 [exp] 92 / 1e-25 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.001G315500 [exp] 84 / 2e-22 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.001G254100 [exp] 76 / 3e-19 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.006G044400 [exp] 75 / 1e-18 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 71 / 3e-17 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.013G113400 [exp] 69 / 2e-16 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.007G051300 [exp] 68 / 3e-16 AT2G14900 61 / 3e-13 Gibberellin-regulated family protein (.1) Potri.002G022500 [exp] 65 / 1e-14 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10001407 pacid=23158811 polypeptide=Lus10001407 locus=Lus10001407.g ID=Lus10001407.BGIv1.0 annot-version=v1.0 ATGAAGCTAGTTCCAGCAGTGTTATCAACTCTGCTACTCATTGTTTCCATGGTTGTTGCCTCCTCATGTTTCATTCAACTCTCAGTTGCTCATGTTAACC CCTCCTCTCCAAATCAAGCAACGGACGTAGGAAGAAGGTGCGAGTCAAAGTGTGAAGGGAGGTGTGCTGCGGCAGGGTACAAAGAGAGATGCTTGAATTA CTGCAACATCTGCTGTTCCAAATGCAGATGCGTCCCTTCTGGTACTTACGGCAATAAGCAAGAGTGCCCTTGCTACCGTGACCTTAGGGATAACAAGGGC AGACCCAAGTGCCCTTAA
AA sequence Show only first row Show all	>Lus10001407 pacid=23158811 polypeptide=Lus10001407 locus=Lus10001407.g ID=Lus10001407.BGIv1.0 annot-version=v1.0 MKLVPAVLSTLLLIVSMVVASSCFIQLSVAHVNPSSPNQATDVGRRCESKCEGRCAAAGYKERCLNYCNICCSKCRCVPSGTYGNKQECPCYRDLRDNKG RPKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59845			Gibberellin-regulated family p...		Lus10001407 [exp]	0	1
AT5G16020		GEX3	gamete-expressed 3 (.1)		Lus10017838 [exp]	1.7	0.7602
AT5G45380		ATDUR3	DEGRADATION OF UREA 3, solute:...		Lus10000112 [exp]	3.2	0.7571
AT5G28300	Trihelix		Duplicated homeodomain-like su...		Lus10015924 [exp]	10.7	0.7310
AT5G45380		ATDUR3	DEGRADATION OF UREA 3, solute:...		Lus10003565 [exp]	13.0	0.7176
AT2G27410	B3		Domain of unknown function (DU...		Lus10015934 [exp]	16.0	0.6191
AT1G09815		POLD4	polymerase delta 4 (.1)		Lus10024978 [exp]	19.6	0.7210
AT4G35230		BSK1	BR-signaling kinase 1 (.1)		Lus10034573 [exp]	28.3	0.6925
AT4G27540		PRA1.H	prenylated RAB acceptor 1.H (....		Lus10028164 [exp]	37.9	0.6361
					Lus10004133 [exp]	44.1	0.6765
AT5G67070		RALFL34	ralf-like 34 (.1)		Lus10003931 [exp]	44.1	0.6651

Compare expression of checked genes

Lus10001407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.