Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06400 87 / 1e-22 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT4G18800 77 / 9e-19 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT5G45750 77 / 1e-18 AtRABA1c RAB GTPase homolog A1C (.1) AT1G28550 74 / 1e-17 AtRABA1i RAB GTPase homolog A1I (.1) AT3G15060 72 / 6e-17 AtRABA1g RAB GTPase homolog A1G (.1) AT5G60860 72 / 1e-16 AtRABA1f RAB GTPase homolog A1F (.1) AT2G33870 71 / 2e-16 ArRABA1h RAB GTPase homolog A1H (.1) AT4G18430 70 / 5e-16 AtRABA1e RAB GTPase homolog A1E (.1) AT1G16920 69 / 1e-15 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT3G12160 68 / 3e-15 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020746 [exp] 87 / 8e-23 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10029789 [exp] 85 / 6e-22 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10029253 [exp] 73 / 2e-17 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10007306 [exp] 73 / 3e-17 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10017679 [exp] 73 / 3e-17 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1) Lus10039895 [exp] 70 / 3e-16 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1) Lus10002178 [exp] 70 / 4e-16 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10015297 [exp] 68 / 3e-15 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10013961 [exp] 67 / 6e-15 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G070300 [exp] 81 / 4e-20 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.004G061000 [exp] 79 / 2e-19 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.001G374000 [exp] 71 / 1e-16 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.011G061300 [exp] 70 / 5e-16 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.006G057700 [exp] 68 / 3e-15 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.001G270100 [exp] 68 / 3e-15 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.016G050400 [exp] 67 / 5e-15 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.013G123600 [exp] 67 / 5e-15 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 66 / 2e-14 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.003G004100 [exp] 64 / 7e-14 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10001422 pacid=23145941 polypeptide=Lus10001422 locus=Lus10001422.g ID=Lus10001422.BGIv1.0 annot-version=v1.0 ATGAGTCAAAGGAGACAGATTGAGCAAGGCCAGTCAGCAGCAGTTGGAAGCCACCTGGTAGCTGTCCGAACAGAGGAAGCTAAAGCATTTGCTGAAAGGG AAACACTCTACTTTATGGAGACGTCAGCTCTAACTGCTACCAATGTGAAGAGCGCCTTCACCCAAGTGCTTAGCCACATTTACAAGATCGTCAGCAAGCG TCCGTCACGGGAAGCAGTGATGGAGCTACCCATGTTCCTCTCAAGGGAGAGGCCATCGATGTTAAGCTGA
AA sequence Show only first row Show all	>Lus10001422 pacid=23145941 polypeptide=Lus10001422 locus=Lus10001422.g ID=Lus10001422.BGIv1.0 annot-version=v1.0 MSQRRQIEQGQSAAVGSHLVAVRTEEAKAFAERETLYFMETSALTATNVKSAFTQVLSHIYKIVSKRPSREAVMELPMFLSRERPSMLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06400		ARA2, AtRABA1a,...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10001422 [exp]	0	1

Compare expression of checked genes

Lus10001422 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.