Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001635 [exp] 207 / 9e-71 AT2G18370 37 / 9e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001634 [exp] 87 / 2e-21 AT4G25910 260 / 7e-87 NFU domain protein 3 (.1) Lus10001432 [exp] 79 / 5e-20 AT2G18370 53 / 6e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038427 [exp] 49 / 3e-08 AT3G51600 42 / 9e-06 lipid transfer protein 5 (.1) Lus10038428 [exp] 42 / 8e-06 ND / Lus10038430 [exp] 38 / 0.0004 ND 37 / 7e-04
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001431 pacid=23170712 polypeptide=Lus10001431 locus=Lus10001431.g ID=Lus10001431.BGIv1.0 annot-version=v1.0 ATGAAGCGAAACACCTTGTTGTTGGGTTTCGTCACAATCGTTATATTCATTTTCGCTATTTTCTCAAGAATTAGCGATGGGTACACATGGCCTCCGAAAT GCGCCGGTTATAGAAAAGCATCGAAGAGCTGCCTTCTCTACGTCAATGGGAATGTAACCGATATCCCTGAAGAGTGTTGTCCTACGCTGAAAACCTATCT GGCACCCGCCAAAGATGATTCCACGAAGAAGAAAGCCGCATGCTATTGCATATCCGACTTCGCCCATGGCGGCAAATACGACAAAGGTCGGGCCAAGGAT GTTCTCAAGAAGTGTGAATTCCCCATCCCACCCTCCTTCTTCGACTGCCGCACGTAA
AA sequence Show only first row Show all	>Lus10001431 pacid=23170712 polypeptide=Lus10001431 locus=Lus10001431.g ID=Lus10001431.BGIv1.0 annot-version=v1.0 MKRNTLLLGFVTIVIFIFAIFSRISDGYTWPPKCAGYRKASKSCLLYVNGNVTDIPEECCPTLKTYLAPAKDDSTKKKAACYCISDFAHGGKYDKGRAKD VLKKCEFPIPPSFFDCRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10001431 [exp]	0	1
					Lus10003840 [exp]	1.0	1.0000
					Lus10005396 [exp]	1.4	1.0000
					Lus10022573 [exp]	1.7	1.0000
					Lus10006661 [exp]	2.0	1.0000
AT5G67210		IRX15-L	IRX15-LIKE, Protein of unknown...		Lus10009378 [exp]	2.2	1.0000
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10038264 [exp]	2.4	1.0000
					Lus10012429 [exp]	2.6	1.0000
AT5G14400		CYP724A1	"cytochrome P450, family 724, ...		Lus10003650 [exp]	2.8	1.0000
AT5G48540			receptor-like protein kinase-r...		Lus10015472 [exp]	3.0	1.0000
AT3G05950			RmlC-like cupins superfamily p...		Lus10029010 [exp]	3.2	1.0000

Compare expression of checked genes

Lus10001431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.