Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18370 54 / 4e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 45 / 9e-07 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT5G59310 40 / 6e-05 LTP4 lipid transfer protein 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001634 [exp] 222 / 1e-73 AT4G25910 260 / 7e-87 NFU domain protein 3 (.1) Lus10001635 [exp] 86 / 2e-22 AT2G18370 37 / 9e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001431 [exp] 84 / 9e-22 AT2G18370 37 / 6e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025151 [exp] 47 / 1e-07 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10025234 [exp] 46 / 5e-07 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10029226 [exp] 45 / 7e-07 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10042210 [exp] 45 / 8e-07 AT5G59320 86 / 6e-23 lipid transfer protein 3 (.1) Lus10026418 [exp] 45 / 1e-06 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10028002 [exp] 44 / 3e-06 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G232700 [exp] 45 / 7e-07 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G025200 [exp] 44 / 1e-06 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 44 / 2e-06 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G098000 [exp] 42 / 1e-05 AT5G59310 71 / 9e-17 lipid transfer protein 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001432 pacid=23170705 polypeptide=Lus10001432 locus=Lus10001432.g ID=Lus10001432.BGIv1.0 annot-version=v1.0 ATGGTTGCTTATAACAACGTTTGCCTGACAGCCACTCTGGCCGTGATTGCGGCCATCGTTTTGATGGCCGGGAACAGTGACGCTGATTGGCCACCTCATT GTGCGGGCTTCGCCAAGTTGGTGACGAAGCCCTGTTTCGACTATGTGACCGGGAAAGCTGCTGAGGTACCGAAACCGTGTTGCGAGGGGTTGGCAACTTT CACGGCGGACGCCAAAAAGTCTACCGACAAAAGAAGGGCGGGTTGCTATTGCGTTAAGCAATCCGCAATGAATCCGCATTATGAGAAGGGCCGAGTCCAG AATGTTGCCACCACTTGCGGTTATAAGCTTCCAAACCCCACCCTTGACTGCCAAACGTACGTAATCTTTTACCCTAAACTTTGA
AA sequence Show only first row Show all	>Lus10001432 pacid=23170705 polypeptide=Lus10001432 locus=Lus10001432.g ID=Lus10001432.BGIv1.0 annot-version=v1.0 MVAYNNVCLTATLAVIAAIVLMAGNSDADWPPHCAGFAKLVTKPCFDYVTGKAAEVPKPCCEGLATFTADAKKSTDKRRAGCYCVKQSAMNPHYEKGRVQ NVATTCGYKLPNPTLDCQTYVIFYPKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10001432 [exp]	0	1
					Lus10037868 [exp]	5.5	0.8547
AT1G53440			Leucine-rich repeat transmembr...		Lus10030626 [exp]	8.9	0.7192
AT4G27670		HSP21	heat shock protein 21 (.1)		Lus10014876 [exp]	9.2	0.8292
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10025597 [exp]	9.6	0.8254
					Lus10038051 [exp]	12.3	0.8244
AT5G01660			unknown protein		Lus10040599 [exp]	13.8	0.8244
AT1G30840		ATPUP4	purine permease 4 (.1.2)		Lus10008073 [exp]	15.0	0.7516
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10014062 [exp]	15.1	0.8244
					Lus10003825 [exp]	16.3	0.8244
					Lus10029261 [exp]	17.4	0.8244

Compare expression of checked genes

Lus10001432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.