Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30010 146 / 1e-47 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015329 [exp] 185 / 6e-63 AT4G30010 146 / 2e-47 unknown protein Lus10001623 [exp] 183 / 3e-62 AT4G30010 144 / 7e-47 unknown protein Lus10025458 [exp] 181 / 2e-61 AT4G30010 142 / 4e-46 unknown protein Lus10001622 [exp] 101 / 4e-27 AT2G18980 320 / 4e-109 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G075600 [exp] 167 / 1e-55 AT4G30010 134 / 9e-43 unknown protein Potri.018G142500 [exp] 165 / 6e-55 AT4G30010 137 / 8e-44 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001443 pacid=23170704 polypeptide=Lus10001443 locus=Lus10001443.g ID=Lus10001443.BGIv1.0 annot-version=v1.0 ATGGCGATGAGGAGGTTCTACAACGAGATCAAGGGGTTGAAGGTGAAGGAGCTCCCAAACCACGTCAAGCCGATGCTGTCGCTTGACTTCGTGAAGAAAT CCGTGCAGAAAGGATTGGATAATTACCACGCCAAGTACATCCAGACCAGCTCCGTCGACCCGCTCCTTCACGTCTGCTTTGGCGGGATGGCCTTCTCCTA TCTTGTTGCCCTTCCCGAGGAGCGTCGTCATCTGGAGCACCAGCAGCACGCCAAAGAGCACGGTGGCCACTGA
AA sequence Show only first row Show all	>Lus10001443 pacid=23170704 polypeptide=Lus10001443 locus=Lus10001443.g ID=Lus10001443.BGIv1.0 annot-version=v1.0 MAMRRFYNEIKGLKVKELPNHVKPMLSLDFVKKSVQKGLDNYHAKYIQTSSVDPLLHVCFGGMAFSYLVALPEERRHLEHQQHAKEHGGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30010			unknown protein		Lus10001443 [exp]	0	1
AT4G13870		WRNEXO, ATWRNEX...	Werner syndrome-like exonuclea...		Lus10039164 [exp]	3.3	0.9313
AT4G00860		AT0ZI1, ATOZI1	Arabidopsis thaliana ozone-ind...		Lus10007542 [exp]	4.2	0.9273
AT2G32980			unknown protein		Lus10030015 [exp]	4.9	0.8789
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10039296 [exp]	6.5	0.9071
AT4G34840		ATMTN2, ATMTAN2	ARABIDOPSIS METHYLTHIOADENOSIN...		Lus10042387 [exp]	7.9	0.9024
AT3G61790			Protein with RING/U-box and TR...		Lus10004001 [exp]	8.0	0.9142
AT4G37830			cytochrome c oxidase-related (...		Lus10019250 [exp]	8.3	0.9268
AT3G26340			N-terminal nucleophile aminohy...		Lus10006426 [exp]	10.0	0.9135
AT3G05545			RING/U-box superfamily protein...		Lus10020655 [exp]	11.4	0.8981
AT3G47810		ATVPS29, MAG1	VACUOLAR PROTEIN SORTING 29, M...		Lus10030497 [exp]	15.6	0.8969

Compare expression of checked genes

Lus10001443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.