Lus10001444 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18840 162 / 2e-46 Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G08305 112 / 2e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G61800 104 / 1e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G61170 103 / 2e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G45350 103 / 2e-25 CRR4 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G08070 103 / 3e-25 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G22070 102 / 7e-25 pentatricopeptide (PPR) repeat-containing protein (.1)
AT3G02330 100 / 2e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G18840 97 / 4e-23 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT2G13600 97 / 5e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022890 112 / 3e-28 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024936 108 / 6e-27 AT3G61170 855 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10017386 99 / 2e-24 AT5G08305 357 / 9e-120 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016425 100 / 3e-24 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10010183 98 / 2e-23 AT5G08305 529 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10004052 98 / 2e-23 AT1G31430 684 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10026006 98 / 3e-23 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10007341 97 / 3e-23 AT2G42920 610 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10005064 97 / 4e-23 AT2G21090 513 / 2e-179 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G152000 227 / 2e-70 AT3G18840 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.004G151500 227 / 2e-70 AT3G18840 773 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.009G113500 219 / 2e-67 AT3G18840 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.002G155100 122 / 7e-32 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G110800 109 / 1e-27 AT5G61800 554 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G085500 108 / 3e-27 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.017G141200 107 / 5e-27 AT5G66520 407 / 1e-135 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G202600 104 / 8e-26 AT2G42920 660 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.017G086100 103 / 2e-25 AT5G15300 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G048800 100 / 4e-24 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10001444 pacid=23170699 polypeptide=Lus10001444 locus=Lus10001444.g ID=Lus10001444.BGIv1.0 annot-version=v1.0
ATGAGACGAAAAGGACTCAGCTTGTTGAATCTCAAACACCGAATCACTGCCCATTCCCGCTCCATCAAGGTTGGTCTCCCGTTATCTGTTCTCATCTCCA
ATCAGCTCATCCACCTCTACTCCGAGCATGGCCTTATCCGCGACGCCCAGAAGCTATTCGAAGAAATGCCTCAAAGAAACCTCTTCTCTTGGAACACCAT
CATATCCGCCCAAGTCAAGTCCCACGACTTGGTCAAGGCTAGAGCTCTCTTTGACTCCGCGCCTCTTCGAGATTCCGTCACTTACAACTCCTTGCTGTCT
GGCTACGTTCGGATCGGTGGTGGTGTGTTTGAGCGTCTTGCATTTGAATTGTTTGTTGATATGCCTCATGAGATGAGAATCGATGAGGTTACTCTCACGA
TCATGGTCAACTTGTGTGCCAAGTCGGAGATGCTATGCTTTGGGACGCAGTTGCAGAGCCACATGGTGAAGACGGCTAACGATTTGAGTGGCTTTTCCGC
CAGTTCTTTAATCGGCATGTACTCGAAGTGTGGATGCTTCCGAGAAGCTTGCTCGGCGTTTGAAACTTGCGAAGTAACGGATGTCGATTCTGTTACCAAG
AACAGCCCCTGGCAGCTTGTTGCAGGGCAGGTGGTGTGGATGCTTCCGAGAAGCTTGCTCGGCATTTGA
AA sequence
>Lus10001444 pacid=23170699 polypeptide=Lus10001444 locus=Lus10001444.g ID=Lus10001444.BGIv1.0 annot-version=v1.0
MRRKGLSLLNLKHRITAHSRSIKVGLPLSVLISNQLIHLYSEHGLIRDAQKLFEEMPQRNLFSWNTIISAQVKSHDLVKARALFDSAPLRDSVTYNSLLS
GYVRIGGGVFERLAFELFVDMPHEMRIDEVTLTIMVNLCAKSEMLCFGTQLQSHMVKTANDLSGFSASSLIGMYSKCGCFREACSAFETCEVTDVDSVTK
NSPWQLVAGQVVWMLPRSLLGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18840 Tetratricopeptide repeat (TPR)... Lus10001444 0 1
AT2G33760 Pentatricopeptide repeat (PPR)... Lus10025490 136.6 0.5829

Lus10001444 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.