Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47270 64 / 2e-14 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) AT3G58850 40 / 2e-05 HLH2, PAR2 phy rapidly regulated 2 (.1) AT2G42870 40 / 5e-05 PAR1 ,HLH1 HELIX-LOOP-HELIX 1, phy rapidly regulated 1 (.1) AT4G30180 37 / 0.0004 bHLH bHLH146 sequence-specific DNA binding transcription factors;transcription regulators (.1) AT3G06590 37 / 0.0006 bHLH bHLH148, AIF2 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) AT4G30410 37 / 0.0006 sequence-specific DNA binding transcription factors (.1.2) AT1G23965 36 / 0.0007 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002419 [exp] 119 / 1e-36 AT2G47270 67 / 4e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10010001 [exp] 53 / 4e-10 AT2G47270 52 / 6e-10 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G118300 [exp] 73 / 1e-17 AT2G47270 62 / 2e-13 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.002G193300 [exp] 72 / 1e-17 AT2G47270 79 / 5e-20 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.002G060100 [exp] 49 / 2e-08 AT3G58850 80 / 4e-20 phy rapidly regulated 2 (.1) Potri.005G201500 [exp] 46 / 2e-07 AT3G58850 82 / 4e-21 phy rapidly regulated 2 (.1) Potri.018G099100 [exp] 40 / 6e-05 AT4G30410 135 / 1e-40 sequence-specific DNA binding transcription factors (.1.2) Potri.017G093000 [exp] 37 / 0.0003 AT5G39240 64 / 3e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001447 pacid=23161025 polypeptide=Lus10001447 locus=Lus10001447.g ID=Lus10001447.BGIv1.0 annot-version=v1.0 ATGGGTGCTGCTGCAGTGATCAATAAGAAGATGAGGAGCTGCAGGAGGGTGATCAGAAGAAGGCCTCCGACGGCCGGAATTAATCGAAGAGTTAGAGCGT TGAAGAAGCTAATACCAAACGGCGAGTCGATGGGAACAGTGGAGGGGCTTTTTAGGGAAACTGCTGATTATATCTTAGGGTTGGAGATGAGGGTTTCACT CATGCAGATTTTGCTTCAAGATCTGACGACGACGACGACGACGACGACTCCTGCAACTACTACTACTTGTGATTCTTATCATCACCATCAGTTTCGAATG TAA
AA sequence Show only first row Show all	>Lus10001447 pacid=23161025 polypeptide=Lus10001447 locus=Lus10001447.g ID=Lus10001447.BGIv1.0 annot-version=v1.0 MGAAAVINKKMRSCRRVIRRRPPTAGINRRVRALKKLIPNGESMGTVEGLFRETADYILGLEMRVSLMQILLQDLTTTTTTTTPATTTTCDSYHHHQFRM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47270	bHLH	bHLH151, UPB1	UPBEAT1, sequence-specific DNA...		Lus10001447 [exp]	0	1
AT2G22590			UDP-Glycosyltransferase superf...		Lus10035951 [exp]	3.0	0.9340
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10031933 [exp]	4.9	0.9116
AT3G19200			unknown protein		Lus10019867 [exp]	7.3	0.9227
AT5G19200		TSC10B	TSC10B, NAD(P)-binding Rossman...		Lus10010510 [exp]	9.9	0.9142
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10020115 [exp]	17.5	0.9106
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10004331 [exp]	19.4	0.9068
AT4G23740			Leucine-rich repeat protein ki...		Lus10027568 [exp]	22.7	0.9114
AT1G06980			unknown protein		Lus10042244 [exp]	22.9	0.9098
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10001732 [exp]	25.1	0.8765
AT1G24430			HXXXD-type acyl-transferase fa...		Lus10025729 [exp]	27.5	0.8953

Compare expression of checked genes

Lus10001447 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.