Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47400 126 / 1e-38 CP12-1 CP12 domain-containing protein 1 (.1) AT3G62410 119 / 6e-36 CP12-2 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) AT1G76560 85 / 3e-22 CP12-3 CP12 domain-containing protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002428 [exp] 234 / 2e-81 AT2G47400 125 / 4e-38 CP12 domain-containing protein 1 (.1) Lus10025025 [exp] 159 / 1e-51 AT2G47400 125 / 2e-38 CP12 domain-containing protein 1 (.1) Lus10010006 [exp] 89 / 5e-24 AT2G47400 59 / 4e-12 CP12 domain-containing protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G120700 [exp] 140 / 5e-44 AT3G62410 122 / 5e-37 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) Potri.002G196100 [exp] 133 / 2e-41 AT3G62410 89 / 8e-24 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) Potri.005G258400 [exp] 80 / 5e-20 AT1G76560 114 / 1e-33 CP12 domain-containing protein 3 (.1) Potri.002G002700 [exp] 79 / 1e-19 AT1G76560 109 / 1e-31 CP12 domain-containing protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02672 [flax] [poplar] CP12 CP12 domain
Representative CDS sequence Show only first row Show all	>Lus10001453 pacid=23161039 polypeptide=Lus10001453 locus=Lus10001453.g ID=Lus10001453.BGIv1.0 annot-version=v1.0 ATGGCGGCTGGTCTCACCCTGTCAACCTCTCCGGCAAGCTGGAAGGCGAGGATGTTAGCAACAACCGCAGCTACACCGAAACAGCAGCCGTTTCTATGTA TGAAGAAGAAGCAGCAAAGGGTGGTCCTGATGAGGGCGGTGCCGGATAAGATTCAAGAAAAAGTAGAAGAGAGCATTAAGGCGGCAGAGGAGACATGCGG TGAGGATCCAGCGAGCGGGGAGTGCGTAGCTGCGTGGGACGAGGTGGAGGAGCTCAGCGCAGCCGCCAGCCACGCTAGGGACAAGAAGAAAGGCTCCGAC CCGCTCGAGGCTTACTGCCAGGACAACCCGGAGACCGACGAGTGCCGCACCTACGACAACTAG
AA sequence Show only first row Show all	>Lus10001453 pacid=23161039 polypeptide=Lus10001453 locus=Lus10001453.g ID=Lus10001453.BGIv1.0 annot-version=v1.0 MAAGLTLSTSPASWKARMLATTAATPKQQPFLCMKKKQQRVVLMRAVPDKIQEKVEESIKAAEETCGEDPASGECVAAWDEVEELSAAASHARDKKKGSD PLEAYCQDNPETDECRTYDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47400		CP12-1	CP12 domain-containing protein...		Lus10001453 [exp]	0	1
AT1G66130			NAD(P)-binding Rossmann-fold s...		Lus10002180 [exp]	1.0	0.9712
AT4G34350		HDR, CLB6, ISPH	CHLOROPLAST BIOGENESIS 6, 4-hy...		Lus10042345 [exp]	1.4	0.9568
AT1G18730		PnsB4, NDF6	Photosynthetic NDH subcomplex...		Lus10001645 [exp]	4.2	0.9560
AT1G52590			Putative thiol-disulphide oxid...		Lus10036091 [exp]	4.7	0.9215
AT2G47400		CP12-1	CP12 domain-containing protein...		Lus10025025 [exp]	6.0	0.9422
AT3G47070			unknown protein		Lus10001204 [exp]	6.0	0.9548
AT1G18730		PnsB4, NDF6	Photosynthetic NDH subcomplex...		Lus10021662 [exp]	7.1	0.9471
AT3G21055		PSBTN	photosystem II subunit T (.1)		Lus10027359 [exp]	8.5	0.9469
AT1G51400			Photosystem II 5 kD protein (....		Lus10014908 [exp]	8.8	0.9446
AT2G30570		PSBW	photosystem II reaction center...		Lus10024858 [exp]	10.5	0.9406

Compare expression of checked genes

Lus10001453 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.