Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61310 80 / 5e-22 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) AT2G47380 80 / 7e-22 Cytochrome c oxidase subunit Vc family protein (.1) AT5G40382 70 / 6e-18 Cytochrome c oxidase subunit Vc family protein (.1) AT3G62400 40 / 5e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002429 [exp] 102 / 1e-30 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10010008 [exp] 102 / 1e-30 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10025028 [exp] 100 / 5e-30 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10040012 [exp] 95 / 7e-28 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10022249 [exp] 71 / 3e-18 AT5G40382 91 / 3e-26 Cytochrome c oxidase subunit Vc family protein (.1) Lus10008765 [exp] 64 / 2e-15 AT5G40382 92 / 6e-27 Cytochrome c oxidase subunit Vc family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G195901 [exp] 86 / 2e-24 AT5G61310 94 / 2e-27 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Potri.014G120500 [exp] 85 / 4e-24 AT5G61310 103 / 3e-31 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10001454 pacid=23161045 polypeptide=Lus10001454 locus=Lus10001454.g ID=Lus10001454.BGIv1.0 annot-version=v1.0 ATGGCTGGCAGGATTCCACATCCGACGTTGAAAGGACCGAGCGTTATCAAGGAAATAGTGATCGGGATTGCCCTTGGCATGGCCGCTGGTGGTCTTTGGA AGATGCATCACTGGAATGAGCAGAGGAAAGTAAGAGCGTTCTATGACATGCTTGAAAAAGGTGAAATCAGTGTCGTTGCTGAAGAATAG
AA sequence Show only first row Show all	>Lus10001454 pacid=23161045 polypeptide=Lus10001454 locus=Lus10001454.g ID=Lus10001454.BGIv1.0 annot-version=v1.0 MAGRIPHPTLKGPSVIKEIVIGIALGMAAGGLWKMHHWNEQRKVRAFYDMLEKGEISVVAEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G61310			Cytochrome c oxidase subunit V...		Lus10001454 [exp]	0	1
AT1G52740		HTA9	histone H2A protein 9 (.1)		Lus10019449 [exp]	1.0	0.8846
AT1G50740			Transmembrane proteins 14C (.1...		Lus10019624 [exp]	4.9	0.8225
AT5G04850		VPS60.2	SNF7 family protein (.1.2)		Lus10008953 [exp]	5.2	0.8227
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10023188 [exp]	6.2	0.8303
AT2G24765		ARF3, ARL1, ATA...	ARF-LIKE 1, ADP-ribosylation f...		Lus10026910 [exp]	6.8	0.7774
AT2G34200			RING/FYVE/PHD zinc finger supe...		Lus10015273 [exp]	7.5	0.7930
AT3G08890			Protein of unknown function, D...		Lus10002862 [exp]	7.9	0.8148
AT4G39235			unknown protein		Lus10004160 [exp]	8.5	0.8184
AT2G21290			unknown protein		Lus10018053 [exp]	9.5	0.7941
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Lus10009706 [exp]	10.7	0.8211

Compare expression of checked genes

Lus10001454 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.