Lus10001462 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26990 124 / 4e-35 Drought-responsive family protein (.1)
AT3G05700 122 / 2e-34 Drought-responsive family protein (.1)
AT4G02200 113 / 9e-31 Drought-responsive family protein (.1.2.3)
AT3G06760 111 / 5e-30 Drought-responsive family protein (.1.2)
AT1G02750 111 / 6e-30 Drought-responsive family protein (.1.2)
AT5G49230 106 / 3e-28 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
AT1G56280 98 / 3e-25 ATDI19 drought-induced 19 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013420 249 / 5e-84 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2)
Lus10010305 247 / 4e-83 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2)
Lus10002441 230 / 6e-78 AT5G26990 95 / 3e-25 Drought-responsive family protein (.1)
Lus10031467 152 / 1e-45 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1)
Lus10037819 110 / 1e-29 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10015214 97 / 1e-24 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1)
Lus10015412 82 / 2e-18 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1)
Lus10017956 72 / 3e-14 AT5G26990 74 / 8e-15 Drought-responsive family protein (.1)
Lus10017097 68 / 1e-13 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G011200 160 / 3e-49 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1)
Potri.005G020900 151 / 9e-46 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1)
Potri.010G000800 149 / 6e-45 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.014G125500 144 / 1e-42 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1)
Potri.002G200500 142 / 6e-42 AT3G05700 152 / 7e-46 Drought-responsive family protein (.1)
Potri.008G213400 139 / 6e-41 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.011G057200 87 / 2e-20 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2)
Potri.019G027300 81 / 2e-19 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.012G086500 71 / 1e-14 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF05605 zf-Di19 Drought induced 19 protein (Di19), zinc-binding
Representative CDS sequence
>Lus10001462 pacid=23161024 polypeptide=Lus10001462 locus=Lus10001462.g ID=Lus10001462.BGIv1.0 annot-version=v1.0
ATGGATGACGATAAGTGGAGCATCGACCTCTCTTCTACTTCCTCTTCTAGGGCTTATCAGCACGATCCTAAGTTTCTATCTGATCTTTGCATTGATTTTG
AGTCACTAGAAGACACAGATGAGTATTTGATGGCGGAATATCCTTGCCCCTATTGCGAAGAGGATTTTGATTTGGTTGATTTGTGCTGCCATATTGATGA
TGAACATCAGTTCGAATCCAAGTCGGAGATGTGTCCGGTTTGTGGCCTAAATGAGGCTATGGACATGGTTTTCCACATAACATCACAACATGGAGACATG
TTTAAGATATCCTTGGCAGTCGGCACCATTTTGAAGTTGAAACGCCGGAAAGGAGATTCACGGTCGTCACTGTCCTTTCTGAAGAAAGATGCAGATGATT
ATGATGTATCCCTATATTCTCGGCCGTCTGCTACCATTGTTTCCCACACTGACCCGTTCCTATCATTCATACAAAACATGCCCTCTCTCGACAAAGCAGA
AGATGATCAGCCATTTCACTCTGCCCATATAGATGCTGGAAAGGGAAAGCCAGAAGATAAACAATGTGACAGTGTTGCTTCGCCTCCTCGATTATCGGTG
AAGGAGCATAGTGAGAAGACTAAGAGGAGTGAGTTTGTACAGGGACTCTTATTGTCCACCATGTTCAGCGATGACTTGTGA
AA sequence
>Lus10001462 pacid=23161024 polypeptide=Lus10001462 locus=Lus10001462.g ID=Lus10001462.BGIv1.0 annot-version=v1.0
MDDDKWSIDLSSTSSSRAYQHDPKFLSDLCIDFESLEDTDEYLMAEYPCPYCEEDFDLVDLCCHIDDEHQFESKSEMCPVCGLNEAMDMVFHITSQHGDM
FKISLAVGTILKLKRRKGDSRSSLSFLKKDADDYDVSLYSRPSATIVSHTDPFLSFIQNMPSLDKAEDDQPFHSAHIDAGKGKPEDKQCDSVASPPRLSV
KEHSEKTKRSEFVQGLLLSTMFSDDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G05700 Drought-responsive family prot... Lus10001462 0 1
AT4G36280 Histidine kinase-, DNA gyrase ... Lus10025978 4.4 0.8018
Lus10028086 8.0 0.7875
AT5G64680 unknown protein Lus10011265 22.0 0.7695
AT4G36290 CRT1 compromised recognition of TCV... Lus10014276 27.5 0.7643
AT1G65420 NPQ7 NONPHOTOCHEMICAL QUENCHING 7, ... Lus10027674 28.8 0.7578
AT5G09225 unknown protein Lus10020870 32.3 0.7354
AT5G06210 RNA binding (RRM/RBD/RNP motif... Lus10013306 37.1 0.7564
AT5G22620 phosphoglycerate/bisphosphogly... Lus10009404 38.6 0.7594
AT4G31720 STG1, TAFII15, ... TBP-ASSOCIATED FACTOR 10, SALT... Lus10005077 39.0 0.7588
AT2G34050 unknown protein Lus10013954 39.1 0.7554

Lus10001462 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.