Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02320 122 / 2e-34 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT4G02300 120 / 1e-33 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G43270 118 / 5e-33 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G53370 116 / 6e-32 ATPMEPCRF pectin methylesterase PCR fragment F (.1) AT3G49220 112 / 2e-30 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G11580 109 / 1e-29 ATPMEPCRA methylesterase PCR A (.1) AT2G45220 108 / 2e-29 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G02810 107 / 6e-29 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G60730 106 / 1e-28 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT4G02330 105 / 4e-28 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008203 [exp] 171 / 2e-52 AT4G02320 497 / 2e-172 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10018103 [exp] 125 / 4e-35 AT3G49220 799 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10006103 [exp] 118 / 4e-33 AT2G45220 592 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10027202 [exp] 119 / 5e-33 AT2G45220 620 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10038917 [exp] 117 / 2e-32 AT2G45220 630 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10010309 [exp] 108 / 2e-29 AT1G02810 575 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10028536 [exp] 103 / 6e-29 AT3G60730 322 / 6e-109 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10009110 [exp] 107 / 9e-29 AT1G23200 501 / 1e-173 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10013416 [exp] 106 / 1e-28 AT1G02810 519 / 2e-180 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G202500 [exp] 136 / 2e-39 AT4G02320 576 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.012G014500 [exp] 120 / 2e-33 AT3G49220 789 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.012G126800 [exp] 118 / 7e-33 AT2G45220 637 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.015G127700 [exp] 117 / 9e-33 AT2G45220 680 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.015G013700 [exp] 118 / 1e-32 AT3G49220 805 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.002G145500 [exp] 116 / 3e-32 AT2G45220 670 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.015G127500 [exp] 115 / 8e-32 AT2G45220 573 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.003G072800 [exp] 113 / 7e-31 AT3G14310 795 / 0.0 pectin methylesterase 3 (.1) Potri.011G025400 [exp] 111 / 2e-30 AT1G11580 638 / 0.0 methylesterase PCR A (.1) Potri.014G067100 [exp] 107 / 7e-29 AT2G45220 691 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF01095 [flax] [poplar] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Lus10001467 pacid=23161031 polypeptide=Lus10001467 locus=Lus10001467.g ID=Lus10001467.BGIv1.0 annot-version=v1.0 ATGGGCTCGTACATAGAGGACATTGTGGACCCCGCCGGGTGGCTCGAGTGGGACGGTTCGTTCGCGCTCAGTACGCTGTACTATGGGGAGTATATGAATA GGGGACCCGGTTCGAATACTACTCGGAGGGTAACATGGCCGGGTTACCGGGTTATTAACAGTTCGGTTGAGGCGAGTCAGTTTACGGTTGGGCAATTTAT TCAGGGGAGCGAGTGGCTCAATAACACCGGTATCCCTTTCACATCTGGTTTGAGTTAG
AA sequence Show only first row Show all	>Lus10001467 pacid=23161031 polypeptide=Lus10001467 locus=Lus10001467.g ID=Lus10001467.BGIv1.0 annot-version=v1.0 MGSYIEDIVDPAGWLEWDGSFALSTLYYGEYMNRGPGSNTTRRVTWPGYRVINSSVEASQFTVGQFIQGSEWLNNTGIPFTSGLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02320			Plant invertase/pectin methyle...		Lus10001467 [exp]	0	1
AT4G02300			Plant invertase/pectin methyle...		Lus10001466 [exp]	1.0	0.9983
AT4G38260			Protein of unknown function (D...		Lus10016023 [exp]	4.5	0.9889
					Lus10006164 [exp]	5.5	0.9887
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10030097 [exp]	5.7	0.9867
AT1G10070		ATBCAT-2	branched-chain amino acid tran...		Lus10032806 [exp]	6.2	0.9579
AT5G20860			Plant invertase/pectin methyle...		Lus10017665 [exp]	6.2	0.9798
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10030409 [exp]	6.3	0.9887
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Lus10031548 [exp]	6.5	0.9751
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000683 [exp]	7.1	0.9887
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Lus10019510 [exp]	7.3	0.9588

Compare expression of checked genes

Lus10001467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.