Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50335 49 / 2e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008207 [exp] 89 / 3e-25 AT5G50335 56 / 3e-12 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G094000 [exp] 60 / 7e-14 AT5G50335 / unknown protein Potri.015G091300 [exp] 56 / 4e-12 AT5G50335 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001469 pacid=23161043 polypeptide=Lus10001469 locus=Lus10001469.g ID=Lus10001469.BGIv1.0 annot-version=v1.0 ATGAAGCAGACAAAAGACGTGAGAGATCATTGCAGTTATTATCAGCAGCAGCAGCAGCAACAACAACAGATACTTCAGTGCAACAAAGGGAAAGTGAAGA AATTCAAGAGGAGCAGCTCTAACCTGGAGGAGGATGGTGTTTCCTCTGCCCTTTTCTTCCTTGCTTGCATTGCCAACATCACTACTACTACTCCTCCTCC TCCTCCTCCTTCTTCTTCTTGA
AA sequence Show only first row Show all	>Lus10001469 pacid=23161043 polypeptide=Lus10001469 locus=Lus10001469.g ID=Lus10001469.BGIv1.0 annot-version=v1.0 MKQTKDVRDHCSYYQQQQQQQQQILQCNKGKVKKFKRSSSNLEEDGVSSALFFLACIANITTTTPPPPPPSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50335			unknown protein		Lus10001469 [exp]	0	1
AT3G24670			Pectin lyase-like superfamily ...		Lus10022817 [exp]	2.0	0.9374
AT5G50335			unknown protein		Lus10008207 [exp]	2.4	0.9140
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10024388 [exp]	2.8	0.9269
AT1G69780	HD	ATHB13	Homeobox-leucine zipper protei...		Lus10030493 [exp]	2.8	0.9225
AT5G12250		TUB6	beta-6 tubulin (.1)		Lus10008528 [exp]	3.0	0.9260
AT3G28857	bHLH	PRE5	Paclobutrazol Resistance 5, ba...		Lus10005248 [exp]	3.2	0.8967
AT3G05100			S-adenosyl-L-methionine-depend...		Lus10001712 [exp]	6.6	0.8452
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032260 [exp]	7.3	0.8769
AT5G23730		EFO2, RUP2	REPRESSOR OF UV-B PHOTOMORPHOG...		Lus10027454 [exp]	11.3	0.8644
AT3G11590			unknown protein		Lus10013312 [exp]	11.5	0.8965

Compare expression of checked genes

Lus10001469 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.