Lus10001472 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011700 100 / 8e-28 ND /
Lus10002600 104 / 4e-27 AT3G14770 62 / 1e-10 Nodulin MtN3 family protein (.1)
Lus10010379 92 / 2e-23 ND /
Lus10039994 85 / 5e-22 ND /
Lus10012943 80 / 7e-19 ND /
Lus10004094 64 / 4e-14 ND /
Lus10037807 64 / 4e-13 ND /
Lus10019054 57 / 1e-10 AT5G56670 48 / 1e-07 Ribosomal protein S30 family protein (.1)
Lus10023772 49 / 8e-08 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10001472 pacid=23157139 polypeptide=Lus10001472 locus=Lus10001472.g ID=Lus10001472.BGIv1.0 annot-version=v1.0
ATGTTGCGTCCACCTGGTGAGGATGCACTGGATTTTCGAGGAGTTGCATCCGTTAGGTATACCATTGAAATGCACTACAACGGTGTCGTAGATACGCACC
ACTACATGTACGGAGCAGTCGCTTGTGTTGACGGTGTGGACCCCGACTTTTTCTCGATCACAGAAATAAACAAGATGATTGAGTTGCTGGATTTCAGGTG
TAAGTTTTTCCAGATCTTGTACTCTGCACCAGTCATGGGAATAGAAGAGGGGTTAGTACCTCTAGAAGGAGAAGCTGACATCATCGTCTTCAATTTCGCC
TTGAATAATGATTTATTGATGAAGGTTTACCTGAGGGAGTTAACTGAGGAACAAGCGAACTTAACGATGGCGAATATAGAACGGGGGAATCCCACAACAT
CTGAGACAACGTCTGGTCCTAAAAGAGATTGA
AA sequence
>Lus10001472 pacid=23157139 polypeptide=Lus10001472 locus=Lus10001472.g ID=Lus10001472.BGIv1.0 annot-version=v1.0
MLRPPGEDALDFRGVASVRYTIEMHYNGVVDTHHYMYGAVACVDGVDPDFFSITEINKMIELLDFRCKFFQILYSAPVMGIEEGLVPLEGEADIIVFNFA
LNNDLLMKVYLRELTEEQANLTMANIERGNPTTSETTSGPKRD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10001472 0 1
Lus10040143 1.0 0.9256
Lus10012495 5.3 0.8218
AT1G76140 Prolyl oligopeptidase family p... Lus10021834 5.8 0.7316
Lus10004634 21.8 0.8060
AT2G45650 MADS AGL6 AGAMOUS-like 6 (.1) Lus10015017 22.5 0.7982
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10019783 25.2 0.8046
Lus10022366 27.1 0.6840
AT5G10520 RBK1 ROP binding protein kinases 1 ... Lus10002659 27.2 0.7880
AT3G05950 RmlC-like cupins superfamily p... Lus10038456 30.8 0.7957
AT5G01140 Protein of unknown function (D... Lus10040317 31.2 0.6601

Lus10001472 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.