Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23760 54 / 9e-11 Copper transport protein family (.1) AT1G01490 49 / 4e-08 Heavy metal transport/detoxification superfamily protein (.1.2) AT1G63960 38 / 0.0001 Copper transport protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039224 [exp] 55 / 3e-11 AT5G23760 81 / 1e-21 Copper transport protein family (.1) Lus10014967 [exp] 51 / 6e-09 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 49 / 7e-08 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 49 / 7e-08 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 49 / 8e-08 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10036395 [exp] 48 / 9e-08 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007455 [exp] 42 / 2e-05 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10017520 [exp] 40 / 4e-05 AT1G01490 52 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027522 [exp] 40 / 4e-05 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G141500 [exp] 74 / 1e-18 AT5G23760 92 / 1e-25 Copper transport protein family (.1) Potri.015G144200 [exp] 55 / 2e-10 AT5G23760 96 / 2e-26 Copper transport protein family (.1) Potri.001G099500 [exp] 52 / 8e-10 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.003G132200 [exp] 49 / 1e-08 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147000 [exp] 46 / 2e-07 AT1G01490 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G089700 [exp] 46 / 3e-07 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147200 [exp] 44 / 8e-07 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073000 [exp] 44 / 8e-07 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147500 [exp] 44 / 1e-06 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G163400 [exp] 44 / 1e-06 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001485 pacid=23157124 polypeptide=Lus10001485 locus=Lus10001485.g ID=Lus10001485.BGIv1.0 annot-version=v1.0 ATGACCATGAATGATGACAAGACTAAGCAGAAAGCCATTGAGGCTGTTGCTGAAATTTATGCTTGTACCAAACGATATATTCACGGTTCCATCTTCCGTG ACCAAGGCAAGGTAGATGACTTCGGTGTGGACTCGATAGAGGCGGATACAAGGGAGAGGAAGCTGACAGTGATCGGGGAGATGGACACAGTTGCAATGGC CAAGAAGCTTACAAAGAGATTAGGGAAAGTTGATATACTCACTGTTGGCCCTGTTGCCAACCAAGGCAAAAACAACAGGAAGAAAGATGATAAGAAGTAA
AA sequence Show only first row Show all	>Lus10001485 pacid=23157124 polypeptide=Lus10001485 locus=Lus10001485.g ID=Lus10001485.BGIv1.0 annot-version=v1.0 MTMNDDKTKQKAIEAVAEIYACTKRYIHGSIFRDQGKVDDFGVDSIEADTRERKLTVIGEMDTVAMAKKLTKRLGKVDILTVGPVANQGKNNRKKDDKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23760			Copper transport protein famil...		Lus10001485 [exp]	0	1
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10029319 [exp]	5.4	0.9130
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10006667 [exp]	6.2	0.9093
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10009340 [exp]	11.8	0.8639
AT3G26590			MATE efflux family protein (.1...		Lus10036851 [exp]	17.9	0.8936
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10022883 [exp]	20.9	0.8762
					Lus10007009 [exp]	24.0	0.8686
AT3G47250			Plant protein of unknown funct...		Lus10020563 [exp]	24.4	0.9089
AT2G25810		TIP4;1	tonoplast intrinsic protein 4;...		Lus10037895 [exp]	27.2	0.8832
AT2G44130			Galactose oxidase/kelch repeat...		Lus10016214 [exp]	28.6	0.8262
AT4G14060			Polyketide cyclase/dehydrase a...		Lus10008932 [exp]	28.8	0.8740

Compare expression of checked genes

Lus10001485 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.