Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00680 134 / 1e-41 ADF8 actin depolymerizing factor 8 (.1) AT1G01750 133 / 2e-41 ADF11 actin depolymerizing factor 11 (.1) AT5G59890 133 / 4e-41 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT3G46010 132 / 9e-41 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT4G25590 129 / 7e-40 ADF7 actin depolymerizing factor 7 (.1) AT5G52360 126 / 1e-38 ADF10 actin depolymerizing factor 10 (.1) AT5G59880 124 / 6e-38 ADF3 actin depolymerizing factor 3 (.1.2) AT4G34970 120 / 3e-36 ADF9 actin depolymerizing factor 9 (.1) AT3G46000 120 / 5e-36 ADF2 actin depolymerizing factor 2 (.1) AT2G31200 120 / 6e-36 ADF6, ATADF6 actin depolymerizing factor 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008489 [exp] 186 / 4e-62 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1) Lus10024418 [exp] 133 / 5e-41 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 130 / 5e-40 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 130 / 5e-40 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10022933 [exp] 126 / 2e-38 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1) Lus10027474 [exp] 122 / 9e-37 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1) Lus10023428 [exp] 127 / 2e-36 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2) Lus10040307 [exp] 125 / 4e-36 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2) Lus10014977 [exp] 117 / 6e-35 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G106200 [exp] 144 / 1e-45 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1) Potri.003G125500 [exp] 140 / 3e-44 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1) Potri.001G236700 [exp] 139 / 9e-44 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.009G028200 [exp] 135 / 3e-42 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.009G028100 [exp] 135 / 4e-42 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2) Potri.008G052100 [exp] 135 / 5e-42 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 135 / 7e-42 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.010G208500 [exp] 127 / 6e-39 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2) Potri.005G223800 [exp] 127 / 1e-38 AT2G31200 225 / 5e-77 actin depolymerizing factor 6 (.1) Potri.012G141600 [exp] 125 / 4e-38 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [flax] [poplar] ADF PF00241 [flax] [poplar] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Lus10001486 pacid=23157129 polypeptide=Lus10001486 locus=Lus10001486.g ID=Lus10001486.BGIv1.0 annot-version=v1.0 ATGTTGATGTCCAGAAATAGACAGGGGAAGGAAAAGATTCAATCTTTCTGCCCCATGTTTAAAGATCCTCCAGCGGGGAATGCCTCGTCCGGTATGGCGG GGAGCGAGGAATGCAAAGAGAGACTCTTGGAGCTCAAGTCCAAGAGGATCCATCGCTTCATCGTGTTCAAGATCGAGGAGAAGAAGCAGAAGGTGACGGT GGAGAAGCTAGGCGACCCTTGCCAAAGCTACAACGATTTCACAGCTAGCTTGCCTGAAAATGAATGCAGATATGGTGTCTTCGATTTCGATTTCACCACT CCCGACGACCTCAACAAGAGCAAAATCTTCTTCATTTCCTGGTCTCCGGATTCGTAA
AA sequence Show only first row Show all	>Lus10001486 pacid=23157129 polypeptide=Lus10001486 locus=Lus10001486.g ID=Lus10001486.BGIv1.0 annot-version=v1.0 MLMSRNRQGKEKIQSFCPMFKDPPAGNASSGMAGSEECKERLLELKSKRIHRFIVFKIEEKKQKVTVEKLGDPCQSYNDFTASLPENECRYGVFDFDFTT PDDLNKSKIFFISWSPDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01750		ADF11	actin depolymerizing factor 11...		Lus10001486 [exp]	0	1
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003453 [exp]	21.0	0.7223
AT2G21540		ATSFH3	SEC14-like 3 (.1.2.3)		Lus10042303 [exp]	25.3	0.7092
AT5G65230	MYB	ATMYB53	myb domain protein 53 (.1)		Lus10039735 [exp]	37.4	0.6950
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Lus10027161 [exp]	52.3	0.6096
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10032218 [exp]	59.2	0.6810
AT5G01780			2-oxoglutarate-dependent dioxy...		Lus10009087 [exp]	92.2	0.5912
AT5G01740			Nuclear transport factor 2 (NT...		Lus10029439 [exp]	117.1	0.6286
AT1G23260		MMZ1 ,UEV1A	UBIQUITIN E2 VARIANT 1A, MMS Z...		Lus10034611 [exp]	134.3	0.5891

Compare expression of checked genes

Lus10001486 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.