Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62510 95 / 7e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 91 / 2e-24 ELP extensin-like protein (.1) AT4G12470 91 / 2e-24 AZI1 azelaic acid induced 1 (.1) AT4G12480 89 / 1e-23 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G00165 87 / 3e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G46890 85 / 4e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46900 84 / 8e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002927 [exp] 110 / 2e-32 AT1G62510 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 99 / 3e-27 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 98 / 5e-27 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024625 [exp] 97 / 6e-27 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 97 / 8e-27 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10024623 [exp] 97 / 1e-26 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 96 / 1e-26 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 96 / 4e-26 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032260 [exp] 95 / 5e-26 AT4G12520 155 / 5e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G025900 [exp] 96 / 9e-27 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 95 / 4e-26 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G256100 [exp] 94 / 4e-26 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 94 / 8e-26 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 92 / 8e-25 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 90 / 4e-24 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 84 / 7e-22 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 78 / 7e-19 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 76 / 9e-18 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 72 / 3e-17 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10001493 pacid=23177062 polypeptide=Lus10001493 locus=Lus10001493.g ID=Lus10001493.BGIv1.0 annot-version=v1.0 ATGGCCGCCACCAAACTCCATGCCCTCATCCTAATAACAAACCTCCTCCTCTTTTTCTCCTCCACCACCATCGCCACTTGCCCGCCAGCCCCATTAGCAC CAGCACCAGCACCGGCAAAGTGTCCAAGTGACACGCTGAAGCTAGGGGCGTGCGTGGACTTGCTAGGCGGCCTGGTTCACTTGGTGGTGGGAACGCCTCC TTCGAGCGAGTGTTGCAGTTTGATCAAAGGACTTGCTGACCTGGAAGCCGCGTTGTGTTTATGTACGGTCATCAAGGCCAACATTCTCGGGATTAAACTC ACCGTGCCGCTAGCTCTCGGCTTGCTCCTCTCTGCCTGTGAGAAGACCGTCCCTCCTGGCTTCAAGTGCTAA
AA sequence Show only first row Show all	>Lus10001493 pacid=23177062 polypeptide=Lus10001493 locus=Lus10001493.g ID=Lus10001493.BGIv1.0 annot-version=v1.0 MAATKLHALILITNLLLFFSSTTIATCPPAPLAPAPAPAKCPSDTLKLGACVDLLGGLVHLVVGTPPSSECCSLIKGLADLEAALCLCTVIKANILGIKL TVPLALGLLLSACEKTVPPGFKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10001493 [exp]	0	1
AT3G46570			Glycosyl hydrolase superfamily...		Lus10000070 [exp]	1.0	0.9010
					Lus10024012 [exp]	1.7	0.8924
AT1G11410			S-locus lectin protein kinase ...		Lus10007610 [exp]	2.4	0.8688
AT5G52850			Pentatricopeptide repeat (PPR)...		Lus10038834 [exp]	3.0	0.8261
					Lus10019512 [exp]	3.6	0.8066
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10004224 [exp]	4.5	0.7967
AT4G16270			Peroxidase superfamily protein...		Lus10017069 [exp]	5.3	0.8931
AT4G26830			O-Glycosyl hydrolases family 1...		Lus10011852 [exp]	5.6	0.7711
AT5G58820			Subtilisin-like serine endopep...		Lus10002245 [exp]	7.5	0.7561
AT4G30030			Eukaryotic aspartyl protease f...		Lus10031450 [exp]	8.9	0.8693

Compare expression of checked genes

Lus10001493 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.