Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32190 57 / 2e-10 Myosin heavy chain-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006190 [exp] 71 / 3e-15 AT4G32190 387 / 1e-124 Myosin heavy chain-related protein (.1) Lus10041037 [exp] 63 / 2e-12 AT4G32190 380 / 1e-122 Myosin heavy chain-related protein (.1) Lus10002923 [exp] 43 / 3e-05 AT4G32250 716 / 0.0 Protein kinase superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G255800 [exp] 73 / 7e-16 AT4G32190 546 / 0.0 Myosin heavy chain-related protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10001498 pacid=23177070 polypeptide=Lus10001498 locus=Lus10001498.g ID=Lus10001498.BGIv1.0 annot-version=v1.0 ATGGAGATTTCAAAGATGGAATCGCATCTGGAGAAGAAGAAAACAGATTTTGAAAGAATGCAGGATGTTGTTCAGATTAAAGAGTCAGAACTGGCGGAAG CTGAGCTCGAACTCCAGGATTTGAAGTCTGAACGGGGAGAACTTTTGCTTGTGTTACAAGAAACAGATTCCAGACTGGTGGATGCAAAGGTGAATCTGGG TAAGGTAAATCAGGAGGTTGCAGAGTTAAGGATGCTGAAGGCTAGCGAAGAAGCGCAACTTCTTCGAGCTAAGGAAGATCACGTCCAGGTTATGCCAGAA GACACATCTCTGGAGATGGTTATAGCGGAAGTTGCTCGTTTCACAGCTCTGACAGAGCATCTGATCAAAAAGGCTGGCATCACGAAATGA
AA sequence Show only first row Show all	>Lus10001498 pacid=23177070 polypeptide=Lus10001498 locus=Lus10001498.g ID=Lus10001498.BGIv1.0 annot-version=v1.0 MEISKMESHLEKKKTDFERMQDVVQIKESELAEAELELQDLKSERGELLLVLQETDSRLVDAKVNLGKVNQEVAELRMLKASEEAQLLRAKEDHVQVMPE DTSLEMVIAEVARFTALTEHLIKKAGITK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G32190			Myosin heavy chain-related pro...		Lus10001498 [exp]	0	1
AT5G43400			Uncharacterised conserved prot...		Lus10016990 [exp]	37.5	0.5599
AT5G05220			unknown protein		Lus10029015 [exp]	43.3	0.5489
AT2G27550		ATC	centroradialis (.1)		Lus10020600 [exp]	44.2	0.6087
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10039721 [exp]	50.3	0.5864
					Lus10040805 [exp]	61.8	0.5651
AT5G39680		EMB2744	EMBRYO DEFECTIVE 2744, Pentatr...		Lus10042368 [exp]	82.9	0.4668
AT5G55490		GEX1, ATGEX1	gamete expressed protein 1 (.1...		Lus10042450 [exp]	90.2	0.5335
AT5G20140			SOUL heme-binding family prote...		Lus10040682 [exp]	91.1	0.5333
AT1G72200			RING/U-box superfamily protein...		Lus10041134 [exp]	102.8	0.5337
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Lus10018411 [exp]	112.4	0.5222

Compare expression of checked genes

Lus10001498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.