Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04100 82 / 7e-19 AUX_IAA IAA10 indoleacetic acid-induced protein 10 (.1) AT4G28640 81 / 1e-18 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT2G33310 77 / 3e-17 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT4G32280 77 / 5e-17 AUX_IAA IAA29 indole-3-acetic acid inducible 29 (.1) AT3G17600 68 / 1e-14 AUX_IAA IAA31 indole-3-acetic acid inducible 31 (.1) AT1G04550 69 / 2e-14 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT5G25890 68 / 2e-14 AUX_IAA IAR2, IAA28 IAA-ALANINE RESISTANT 2, indole-3-acetic acid inducible 28 (.1) AT1G80390 68 / 2e-14 AUX_IAA IAA15 indole-3-acetic acid inducible 15 (.1) AT1G15580 68 / 2e-14 AUX_IAA ATAUX2-27, IAA5 AUXIN-INDUCIBLE 2-27, indole-3-acetic acid inducible 5 (.1) AT3G16500 69 / 3e-14 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002921 [exp] 242 / 1e-82 ND 45 / 7e-06 Lus10014464 [exp] 76 / 3e-16 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10023719 [exp] 76 / 3e-16 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10002723 [exp] 74 / 4e-16 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10018764 [exp] 74 / 5e-16 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10022868 [exp] 74 / 6e-16 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3) Lus10024853 [exp] 73 / 8e-16 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10019241 [exp] 73 / 2e-15 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2) Lus10014729 [exp] 71 / 3e-15 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G255200 [exp] 105 / 4e-28 AT4G32280 137 / 7e-40 indole-3-acetic acid inducible 29 (.1) Potri.006G066600 [exp] 86 / 8e-21 AT4G28640 104 / 3e-27 indole-3-acetic acid inducible 11 (.1.2.3) Potri.018G127800 [exp] 77 / 2e-17 AT1G04550 94 / 2e-23 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) Potri.008G172400 [exp] 74 / 8e-16 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.010G065200 [exp] 74 / 1e-15 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.001G177500 [exp] 71 / 2e-15 AT3G15540 224 / 4e-75 MASSUGU 2, indole-3-acetic acid inducible 19 (.1) Potri.003G056900 [exp] 69 / 8e-15 AT3G15540 206 / 4e-68 MASSUGU 2, indole-3-acetic acid inducible 19 (.1) Potri.010G078300 [exp] 69 / 3e-14 AT4G14550 319 / 1e-110 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 69 / 4e-14 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.005G053800 [exp] 68 / 4e-14 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10001501 pacid=23177063 polypeptide=Lus10001501 locus=Lus10001501.g ID=Lus10001501.BGIv1.0 annot-version=v1.0 ATGGAGCTTGAACTCGGCCTCTCTCTCCCGCCGGCCACGTTGGAACTTAACGGCACCGTCAACCCCATTGAGAAGTGGCCAAATGGATACTACGAGGATA ATGGTACCACTCCACATCATGGTGACGACAGCTGCCTCGTTGACGATGAAACGACGTCGTCTGCAGGAACAATGACGACGCTGCCGTTGTTTGTGTGGAC TGGACGGCGGCCACCCGAGGACGACCACAACAACACCTCTAAGGGCCGCCGCAGCAGATTCGTGAAGGTGAAAATGGCCGGGGAGGCTATCATTCGGAAG ATCGATCTCAACCGTTATGATTCGTATCATTCTCTTACACACTCCCTCCTTTATATGTTTGCTAAATGCGGCACAAGCAAACAGTCCGTTGATGAAGATT GTGGGAGCTATACGCTGTCGTATCAAGACGAAGCTGGAAACTGGCGACTAGCTGGAGAAGTTCCATGGCAGAAATTTTGTGGTTCTGTGCAGCGTATGGA GATACTGAGGACAAGTGATGGCCGCCTGGCTATGGACAAGTATGAACCATTGAAGACGACGCAGAGTCGGTAG
AA sequence Show only first row Show all	>Lus10001501 pacid=23177063 polypeptide=Lus10001501 locus=Lus10001501.g ID=Lus10001501.BGIv1.0 annot-version=v1.0 MELELGLSLPPATLELNGTVNPIEKWPNGYYEDNGTTPHHGDDSCLVDDETTSSAGTMTTLPLFVWTGRRPPEDDHNNTSKGRRSRFVKVKMAGEAIIRK IDLNRYDSYHSLTHSLLYMFAKCGTSKQSVDEDCGSYTLSYQDEAGNWRLAGEVPWQKFCGSVQRMEILRTSDGRLAMDKYEPLKTTQSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04100	AUX_IAA	IAA10	indoleacetic acid-induced prot...		Lus10001501 [exp]	0	1
AT4G17970		ATALMT12, ALMT1...	"aluminum-activated, malate tr...		Lus10004556 [exp]	1.0	0.9985
AT3G43860		ATGH9A4	glycosyl hydrolase 9A4 (.1)		Lus10038075 [exp]	11.6	0.9888
AT3G21720		ICL	isocitrate lyase (.1)		Lus10031552 [exp]	14.2	0.9982
AT5G35750		AHK2	histidine kinase 2 (.1)		Lus10009736 [exp]	17.4	0.9982
AT3G29810		COBL2	COBRA-like protein 2 precursor...		Lus10026288 [exp]	17.7	0.9786
					Lus10027374 [exp]	20.1	0.9982
AT4G16230			GDSL-like Lipase/Acylhydrolase...		Lus10016916 [exp]	22.1	0.9929
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031145 [exp]	22.5	0.9913
AT4G17260			Lactate/malate dehydrogenase f...		Lus10028931 [exp]	22.5	0.9982
AT5G16023		RTFL18, DVL1	DEVIL 1, ROTUNDIFOLIA like 18 ...		Lus10003079 [exp]	24.6	0.9803

Compare expression of checked genes

Lus10001501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.